DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cks85A and Cks30A

DIOPT Version :9

Sequence 1:NP_001246992.1 Gene:Cks85A / 41034 FlyBaseID:FBgn0037613 Length:96 Species:Drosophila melanogaster
Sequence 2:NP_476947.1 Gene:Cks30A / 34250 FlyBaseID:FBgn0010314 Length:74 Species:Drosophila melanogaster


Alignment Length:68 Identity:46/68 - (67%)
Similarity:58/68 - (85%) Gaps:0/68 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IQYSEKYFDDNFEYRHVILPPDLAKHVPKAHLMTETEWRNLGVQQSPGWVHYMVHAPEPHVILFR 70
            |.||:||:|:.||||||:||.:|.|.|||.|||||.|||::|||||.||:|||:|.||||::|||
  Fly     5 IYYSDKYYDEQFEYRHVVLPKELVKMVPKTHLMTEAEWRSIGVQQSRGWIHYMIHKPEPHILLFR 69

  Fly    71 RKR 73
            |.:
  Fly    70 RPK 72

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cks85ANP_001246992.1 CKS 8..73 CDD:279455 45/64 (70%)
Cks30ANP_476947.1 CKS 7..72 CDD:395882 45/64 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471274
Domainoid 1 1.000 117 1.000 Domainoid score I1954
eggNOG 1 0.900 - - E1_KOG3484
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 117 1.000 Inparanoid score I2007
Isobase 1 0.950 - 0 Normalized mean entropy S367
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D135032at33392
OrthoFinder 1 1.000 - - FOG0001114
OrthoInspector 1 1.000 - - otm14135
orthoMCL 1 0.900 - - OOG6_100899
Panther 1 1.100 - - P PTHR23415
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X683
1211.750

Return to query results.
Submit another query.