DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cks85A and suc1

DIOPT Version :9

Sequence 1:NP_001246992.1 Gene:Cks85A / 41034 FlyBaseID:FBgn0037613 Length:96 Species:Drosophila melanogaster
Sequence 2:NP_595431.1 Gene:suc1 / 2540027 PomBaseID:SPBC1734.14c Length:113 Species:Schizosaccharomyces pombe


Alignment Length:79 Identity:37/79 - (46%)
Similarity:51/79 - (64%) Gaps:9/79 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DQIQYSEKYFDDNFEYRHVILPPDLAKHVPKAH---------LMTETEWRNLGVQQSPGWVHYMV 59
            |||.||.:|.||.:|||||:||..:.|.:|..:         ::.|.|||.||:.||.||..|.|
pombe    23 DQIHYSPRYADDEYEYRHVMLPKAMLKAIPTDYFNPETGTLRILQEEEWRGLGITQSLGWEMYEV 87

  Fly    60 HAPEPHVILFRRKR 73
            |.||||::||:|::
pombe    88 HVPEPHILLFKREK 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cks85ANP_001246992.1 CKS 8..73 CDD:279455 34/73 (47%)
suc1NP_595431.1 CKS 27..101 CDD:279455 34/73 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 84 1.000 Domainoid score I2223
eggNOG 1 0.900 - - E1_KOG3484
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I1807
OMA 1 1.010 - - QHG53792
OrthoFinder 1 1.000 - - FOG0001114
OrthoInspector 1 1.000 - - otm47273
orthoMCL 1 0.900 - - OOG6_100899
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X683
TreeFam 1 0.960 - -
109.730

Return to query results.
Submit another query.