DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cks85A and cks-1

DIOPT Version :9

Sequence 1:NP_001246992.1 Gene:Cks85A / 41034 FlyBaseID:FBgn0037613 Length:96 Species:Drosophila melanogaster
Sequence 2:NP_001379647.1 Gene:cks-1 / 177658 WormBaseID:WBGene00001051 Length:94 Species:Caenorhabditis elegans


Alignment Length:64 Identity:43/64 - (67%)
Similarity:53/64 - (82%) Gaps:0/64 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 YSEKYFDDNFEYRHVILPPDLAKHVPKAHLMTETEWRNLGVQQSPGWVHYMVHAPEPHVILFRR 71
            ||.||.||.||||||.:..|::|.:||..||:|||||:||:||||||:|||:|.||.||:||||
 Worm    10 YSNKYEDDEFEYRHVHVTKDVSKLIPKNRLMSETEWRSLGIQQSPGWMHYMIHGPERHVLLFRR 73

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cks85ANP_001246992.1 CKS 8..73 CDD:279455 43/64 (67%)
cks-1NP_001379647.1 CKS 10..75 CDD:395882 43/64 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160167360
Domainoid 1 1.000 106 1.000 Domainoid score I4106
eggNOG 1 0.900 - - E1_KOG3484
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H123798
Inparanoid 1 1.050 108 1.000 Inparanoid score I3482
Isobase 1 0.950 - 0 Normalized mean entropy S367
OMA 1 1.010 - - QHG53792
OrthoDB 1 1.010 - - D1377855at2759
OrthoFinder 1 1.000 - - FOG0001114
OrthoInspector 1 1.000 - - otm14135
orthoMCL 1 0.900 - - OOG6_100899
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X683
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.620

Return to query results.
Submit another query.