DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cks85A and Y71G12B.27

DIOPT Version :9

Sequence 1:NP_001246992.1 Gene:Cks85A / 41034 FlyBaseID:FBgn0037613 Length:96 Species:Drosophila melanogaster
Sequence 2:NP_490896.1 Gene:Y71G12B.27 / 171745 WormBaseID:WBGene00022162 Length:118 Species:Caenorhabditis elegans


Alignment Length:70 Identity:43/70 - (61%)
Similarity:53/70 - (75%) Gaps:0/70 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DQIQYSEKYFDDNFEYRHVILPPDLAKHVPKAHLMTETEWRNLGVQQSPGWVHYMVHAPEPHVIL 68
            :.|.||.:|.||.:||||||||..:::.|||..|::|.|||..|||||.||.|||||.||.|::|
 Worm     2 EDIYYSPRYEDDEYEYRHVILPQAVSRKVPKGRLLSEAEWRRAGVQQSLGWEHYMVHNPEKHILL 66

  Fly    69 FRRKR 73
            |||||
 Worm    67 FRRKR 71

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cks85ANP_001246992.1 CKS 8..73 CDD:279455 40/64 (63%)
Y71G12B.27NP_490896.1 CKS 6..71 CDD:279455 40/64 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3484
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S367
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377855at2759
OrthoFinder 1 1.000 - - FOG0001114
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100899
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X683
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.630

Return to query results.
Submit another query.