DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cks85A and AgaP_AGAP003796

DIOPT Version :9

Sequence 1:NP_001246992.1 Gene:Cks85A / 41034 FlyBaseID:FBgn0037613 Length:96 Species:Drosophila melanogaster
Sequence 2:XP_310353.5 Gene:AgaP_AGAP003796 / 1271535 VectorBaseID:AGAP003796 Length:80 Species:Anopheles gambiae


Alignment Length:81 Identity:65/81 - (80%)
Similarity:73/81 - (90%) Gaps:2/81 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPADQIQYSEKYFDDNFEYRHVILPPDLAKHVPKAHLMTETEWRNLGVQQSPGWVHYMVHAPEPH 65
            ||:|||||||||:||.:|||||||||||||:|||.||||||||||||||||||||.||:|:||||
Mosquito     1 MPSDQIQYSEKYYDDVYEYRHVILPPDLAKYVPKTHLMTETEWRNLGVQQSPGWVLYMIHSPEPH 65

  Fly    66 VILFRRKRIPAEDAPQ 81
            |:||||.|  .:.|||
Mosquito    66 VLLFRRPR--TDLAPQ 79

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cks85ANP_001246992.1 CKS 8..73 CDD:279455 55/64 (86%)
AgaP_AGAP003796XP_310353.5 CKS 8..73 CDD:279455 55/64 (86%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 131 1.000 Domainoid score I10422
eggNOG 1 0.900 - - E1_KOG3484
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H123798
Inparanoid 1 1.050 143 1.000 Inparanoid score I6896
OMA 1 1.010 - - QHG53792
OrthoDB 1 1.010 - - D1377855at2759
OrthoFinder 1 1.000 - - FOG0001114
OrthoInspector 1 1.000 - - oto108821
Panther 1 1.100 - - LDO PTHR23415
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X683
TreeFam 1 0.960 - -
1312.940

Return to query results.
Submit another query.