DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cks85A and LOC120102505

DIOPT Version :9

Sequence 1:NP_001246992.1 Gene:Cks85A / 41034 FlyBaseID:FBgn0037613 Length:96 Species:Drosophila melanogaster
Sequence 2:XP_038964963.1 Gene:LOC120102505 / 120102505 RGDID:41219320 Length:79 Species:Rattus norvegicus


Alignment Length:73 Identity:45/73 - (61%)
Similarity:60/73 - (82%) Gaps:1/73 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 QIQYSEKYFDDNFEYRHVILPPDLAKHVPKAHLMTETEWRNLGVQQSPGWVHYMVHAPEPHVILF 69
            ||.||:|||:.::||.||:||.:|:|.|||.|||:|.|||.||||::.||||||:|.||||::||
  Rat     5 QIYYSDKYFNKHYEYWHVMLPRELSKQVPKTHLMSEEEWRRLGVQKNLGWVHYMIHEPEPHILLF 69

  Fly    70 RRKRIPAE 77
            |:. :|.|
  Rat    70 RQP-LPKE 76

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cks85ANP_001246992.1 CKS 8..73 CDD:279455 41/64 (64%)
LOC120102505XP_038964963.1 CKS 8..73 CDD:395882 41/65 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53792
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001114
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100899
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X683
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.820

Return to query results.
Submit another query.