DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cks85A and cks1b

DIOPT Version :9

Sequence 1:NP_001246992.1 Gene:Cks85A / 41034 FlyBaseID:FBgn0037613 Length:96 Species:Drosophila melanogaster
Sequence 2:NP_001093685.1 Gene:cks1b / 100101691 XenbaseID:XB-GENE-921479 Length:78 Species:Xenopus tropicalis


Alignment Length:71 Identity:50/71 - (70%)
Similarity:60/71 - (84%) Gaps:0/71 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPADQIQYSEKYFDDNFEYRHVILPPDLAKHVPKAHLMTETEWRNLGVQQSPGWVHYMVHAPEPH 65
            |.|..|.||:||.|:.:|||||:||.|:||.|||.|||:|:||||||||||.||||||:|.||||
 Frog     1 MSAKNIYYSDKYDDELYEYRHVMLPKDIAKMVPKTHLMSESEWRNLGVQQSQGWVHYMIHEPEPH 65

  Fly    66 VILFRR 71
            ::||||
 Frog    66 ILLFRR 71

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cks85ANP_001246992.1 CKS 8..73 CDD:279455 47/64 (73%)
cks1bNP_001093685.1 CKS 8..73 CDD:307317 47/64 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H123798
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377855at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.