powered by:
Protein Alignment Cks85A and cks1b
DIOPT Version :9
Sequence 1: | NP_001246992.1 |
Gene: | Cks85A / 41034 |
FlyBaseID: | FBgn0037613 |
Length: | 96 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001093685.1 |
Gene: | cks1b / 100101691 |
XenbaseID: | XB-GENE-921479 |
Length: | 78 |
Species: | Xenopus tropicalis |
Alignment Length: | 71 |
Identity: | 50/71 - (70%) |
Similarity: | 60/71 - (84%) |
Gaps: | 0/71 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MPADQIQYSEKYFDDNFEYRHVILPPDLAKHVPKAHLMTETEWRNLGVQQSPGWVHYMVHAPEPH 65
|.|..|.||:||.|:.:|||||:||.|:||.|||.|||:|:||||||||||.||||||:|.||||
Frog 1 MSAKNIYYSDKYDDELYEYRHVMLPKDIAKMVPKTHLMSESEWRNLGVQQSQGWVHYMIHEPEPH 65
Fly 66 VILFRR 71
::||||
Frog 66 ILLFRR 71
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Cks85A | NP_001246992.1 |
CKS |
8..73 |
CDD:279455 |
47/64 (73%) |
cks1b | NP_001093685.1 |
CKS |
8..73 |
CDD:307317 |
47/64 (73%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
1 |
1.000 |
- |
- |
|
H123798 |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1377855at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.010 |
|
Return to query results.
Submit another query.