DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8112 and AT1G35420

DIOPT Version :9

Sequence 1:NP_731269.2 Gene:CG8112 / 41033 FlyBaseID:FBgn0037612 Length:559 Species:Drosophila melanogaster
Sequence 2:NP_001185140.1 Gene:AT1G35420 / 840434 AraportID:AT1G35420 Length:315 Species:Arabidopsis thaliana


Alignment Length:156 Identity:28/156 - (17%)
Similarity:56/156 - (35%) Gaps:41/156 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   215 PHSSLQRFWSHSC---LILYISSQLVFCFVSTSLCLKF-----NLPFVSACILLLEST--RLLMK 269
            |.|...|..||..   .|:.::|.::||.:...:...|     :|..:.|    ||::  .:.::
plant    17 PRSLFNRHGSHRLPPPQIIPLASSIMFCQIKKHITTSFYRRGSSLKNIYA----LETSDGAINVE 77

  Fly   270 MHAFVRYNAERVLNGKAKKEDAEEE-----------------------KEGSERPFVPPLSCYTY 311
            :.......|..::||.....|..|.                       ::.:.|.|...::|..|
plant    78 VDDDEEEEACELVNGTEVSVDGVEGYLLTAVKNNNGTGLLLLSDVFGFQDSATRDFAYRVACNGY 142

  Fly   312 FLFAPTLIYRDSY----PRTSHIRWK 333
            .:..|.|...|.:    |::.:..|:
plant   143 NVLVPDLFRGDPWSKNRPKSEYEEWR 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8112NP_731269.2 MBOAT <231..473 CDD:294479 22/137 (16%)
AT1G35420NP_001185140.1 Abhydrolase 92..314 CDD:304388 12/77 (16%)
MhpC <243..304 CDD:223669
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1275897at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.