DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8112 and AT3G23570

DIOPT Version :9

Sequence 1:NP_731269.2 Gene:CG8112 / 41033 FlyBaseID:FBgn0037612 Length:559 Species:Drosophila melanogaster
Sequence 2:NP_001326293.1 Gene:AT3G23570 / 821936 AraportID:AT3G23570 Length:239 Species:Arabidopsis thaliana


Alignment Length:48 Identity:12/48 - (25%)
Similarity:17/48 - (35%) Gaps:5/48 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 EDVLQDLRQRELRAHEFPNFERSDRKSTWHNRVTSQAPADVSDSTNGH 95
            ||:|....|.:.....||..     |..|..|.....|::|..:...|
plant   185 EDILASKPQVKSFVKIFPRC-----KHGWTVRYNENDPSEVEAAMEAH 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8112NP_731269.2 MBOAT <231..473 CDD:294479
AT3G23570NP_001326293.1 Abhydrolase 41..239 CDD:304388 12/48 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1275897at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.