powered by:
Protein Alignment CG8112 and AT3G23570
DIOPT Version :9
Sequence 1: | NP_731269.2 |
Gene: | CG8112 / 41033 |
FlyBaseID: | FBgn0037612 |
Length: | 559 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001326293.1 |
Gene: | AT3G23570 / 821936 |
AraportID: | AT3G23570 |
Length: | 239 |
Species: | Arabidopsis thaliana |
Alignment Length: | 48 |
Identity: | 12/48 - (25%) |
Similarity: | 17/48 - (35%) |
Gaps: | 5/48 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 48 EDVLQDLRQRELRAHEFPNFERSDRKSTWHNRVTSQAPADVSDSTNGH 95
||:|....|.:.....||.. |..|..|.....|::|..:...|
plant 185 EDILASKPQVKSFVKIFPRC-----KHGWTVRYNENDPSEVEAAMEAH 227
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG8112 | NP_731269.2 |
MBOAT |
<231..473 |
CDD:294479 |
|
AT3G23570 | NP_001326293.1 |
Abhydrolase |
41..239 |
CDD:304388 |
12/48 (25%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1275897at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.