DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8112 and cmbl

DIOPT Version :9

Sequence 1:NP_731269.2 Gene:CG8112 / 41033 FlyBaseID:FBgn0037612 Length:559 Species:Drosophila melanogaster
Sequence 2:NP_988901.1 Gene:cmbl / 394496 XenbaseID:XB-GENE-5806009 Length:246 Species:Xenopus tropicalis


Alignment Length:200 Identity:37/200 - (18%)
Similarity:62/200 - (31%) Gaps:72/200 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   359 EHFGQYGLEPMGPSQ----LILKLFGMMLPS-----------AVIFLC-GFYLILHSWLNFTSEL 407
            ||...|..:|...:.    ::..:||..||:           ..|.:| .|::....|       
 Frog    28 EHIKAYVSKPHSSTDKAVIVVQDIFGWQLPNTRFMADLLTAHGYITICPDFFVGQEPW------- 85

  Fly   408 LRFGDRMFYKDWWTSHTYDGYYRNWNVVVHDWLYEYVYKDMYTHVFRGSKVAASLAVFMISAVVH 472
            ....||..:.:|..:.......:..|||:.       |.....||   .|:.             
 Frog    86 KPSNDRSTFTEWLQTRQATKVEKEINVVLK-------YLKEQCHV---KKIG------------- 127

  Fly   473 EQVLGFALQMFFPVMFFFFGVVGVALVFLMRSAPKVMGNIFLW---------FSLILGNATLISL 528
              |:||.           :|  ||....||...|::...:..:         ::|:  |.||...
 Frog   128 --VIGFC-----------WG--GVVTHHLMLKYPELKAGVSFYGIIRDVEDRYNLL--NPTLFIF 175

  Fly   529 YAMEH 533
            ..|:|
 Frog   176 AEMDH 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8112NP_731269.2 MBOAT <231..473 CDD:294479 22/129 (17%)
cmblNP_988901.1 DLH 13..246 CDD:223489 36/199 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1275897at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.