powered by:
Protein Alignment CG8112 and K02A2.1
DIOPT Version :9
Sequence 1: | NP_731269.2 |
Gene: | CG8112 / 41033 |
FlyBaseID: | FBgn0037612 |
Length: | 559 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_495556.1 |
Gene: | K02A2.1 / 186856 |
WormBaseID: | WBGene00019288 |
Length: | 158 |
Species: | Caenorhabditis elegans |
Alignment Length: | 65 |
Identity: | 15/65 - (23%) |
Similarity: | 21/65 - (32%) |
Gaps: | 20/65 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 281 VLNGKAKKEDAEEEKEGSERPFVPPLSCYTYFLFAPTLIYRDSYPRTSHIR-WKFALNRLLEVVA 344
:.:|||.....:.|..| .||:.: .|...:..| ||..|..|.|..|
Worm 113 ISHGKAMHSFTDPESAG----------------IAPSGV---GYDANAEKRSWKATLEFLKEAFA 158
Fly 345 344
Worm 159 158
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1275897at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.