DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hb and Zscan29

DIOPT Version :9

Sequence 1:NP_731267.1 Gene:hb / 41032 FlyBaseID:FBgn0001180 Length:758 Species:Drosophila melanogaster
Sequence 2:NP_001277748.1 Gene:Zscan29 / 99334 MGIID:2139317 Length:834 Species:Mus musculus


Alignment Length:173 Identity:48/173 - (27%)
Similarity:67/173 - (38%) Gaps:34/173 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   211 EDMKY----MAESEDDDTNIRMPIYNSHGKMKNYKCKTCGVVAITKVDFWAHTRTHM--KPDKIL 269
            ||..|    ..:|...::::|.|:  ||.....|||..||...........|.|.|.  ||.|.|
Mouse   634 EDRPYKYVKYGKSSGSNSHLRYPV--SHEVENPYKCADCGKSFSRSARLIRHQRIHTGEKPYKCL 696

  Fly   270 QCPK-----CPFVTEFKHH--------------------LEYHIRKHKNQKPFQCDKCSYTCVNK 309
            .|.|     ..|:|..:.|                    |..|.|.|..:||:||::|..:..|.
Mouse   697 DCGKGFRDSSNFITHRRIHTGEKPYQCDECGKRFNQSSSLIIHQRTHTGEKPYQCEECGKSFNNS 761

  Fly   310 SMLNSHRKSHSSVYQYRCADCDYATKYCHSFKLHLRKY-GHKP 351
            |..|:||:.|:....:.|.||..:.........|.|.: |.||
Mouse   762 SHFNAHRRIHTGERPHVCPDCGKSFSKSSDLHAHHRTHTGKKP 804

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hbNP_731267.1 C2H2 Zn finger 242..262 CDD:275368 5/19 (26%)
C2H2 Zn finger 271..291 CDD:275368 8/44 (18%)
zf-H2C2_2 283..308 CDD:290200 10/44 (23%)
C2H2 Zn finger 299..319 CDD:275368 7/19 (37%)
C2H2 Zn finger 327..345 CDD:275368 4/17 (24%)
C2H2 Zn finger 707..727 CDD:275371
C2H2 Zn finger 735..757 CDD:275371
Zscan29NP_001277748.1 SCAN 13..123 CDD:128708
SCAN 13..101 CDD:280241
Myb_DNA-bind_4 238..319 CDD:290549
Myb_DNA-bind_4 399..480 CDD:290549
COG5048 <663..823 CDD:227381 40/142 (28%)
zf-C2H2 665..687 CDD:278523 7/21 (33%)
C2H2 Zn finger 667..687 CDD:275368 5/19 (26%)
zf-H2C2_2 680..702 CDD:290200 9/21 (43%)
C2H2 Zn finger 695..715 CDD:275368 5/19 (26%)
zf-H2C2_2 707..732 CDD:290200 3/24 (13%)
C2H2 Zn finger 723..743 CDD:275368 3/19 (16%)
zf-H2C2_2 735..760 CDD:290200 9/24 (38%)
C2H2 Zn finger 751..771 CDD:275368 7/19 (37%)
zf-H2C2_2 763..787 CDD:290200 7/23 (30%)
zf-C2H2 777..799 CDD:278523 5/21 (24%)
C2H2 Zn finger 779..799 CDD:275368 5/19 (26%)
C2H2 Zn finger 807..827 CDD:275368
zf-C2H2 807..827 CDD:278523
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167847309
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.