DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hb and Zfp202

DIOPT Version :9

Sequence 1:NP_731267.1 Gene:hb / 41032 FlyBaseID:FBgn0001180 Length:758 Species:Drosophila melanogaster
Sequence 2:NP_109638.2 Gene:Zfp202 / 80902 MGIID:1933401 Length:641 Species:Mus musculus


Alignment Length:470 Identity:101/470 - (21%)
Similarity:146/470 - (31%) Gaps:160/470 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 HLDGNSVASSPRQSPIPSTNHLEQFLKQQQQQLQQQPMDTLCAMTP------SP--SQNDQNSLQ 90
            |:.|..|.|.       .|.||.  |:.:....||.|..||....|      ||  ...:|.:||
Mouse   138 HVQGQEVLSE-------ETLHLG--LEPESSSEQQDPTQTLTTEQPHEEALRSPDLGTQEQETLQ 193

  Fly    91 HYDANLQQQLLQQQQ--YQQHFQAAQQQHHHHHHLMGGFNPLTPPGLP----------------- 136
            |.:.:|.   |.:.:  ..|......:|...|..::.....|: .||.                 
Mouse   194 HDEEHLP---LPECEVPVSQDVDLPTEQGSGHPEMVALLTALS-QGLVTFKDVALCFSQDQWSDL 254

  Fly   137 NPMQ-HFYGGNLR------------PSPQPTPTSASTIAPVAVATGSSEKLQALTPPM------- 181
            :|.| .|||..:.            |.|:...||........| .|..|..:...|.:       
Mouse   255 DPTQKEFYGEYVLEEDCGIVVSLSFPIPRLDDTSQIREEEPQV-PGVHESQEPAEPEILSFTYTG 318

  Fly   182 DVTPPKSPA-------KSSQSNIE----PEKE---HDQMSNSSEDMKYMAESEDDDTNIR--MPI 230
            |::..:..:       ||:.:|.|    |:.|   .|..|..:|.........:..||||  ||:
Mouse   319 DMSEAEEESVEQQDTHKSTLANTEVHQSPDWEIVIEDNTSRLNERFGTNVSKVNSFTNIRETMPV 383

  Fly   231 YNSHGKMKNYKCKTCGVVAITKVDFWAHTRTHM--KPDKILQCPKC--------------PFVTE 279
            ::..|  :.:.|..|............|.|||.  ||.|.::|.|.              ...|.
Mouse   384 HSQSG--RQHHCPLCAKSFTCNSHLIRHLRTHTGEKPYKCMECGKSYTRSSHLARHQKVHKMNTP 446

  Fly   280 FKH-------------------------------HLEY------HIRKHKNQKPFQCDKCSYTCV 307
            .||                               |..:      |.|.|..:|||.|..||.:..
Mouse   447 HKHPPNRKTVDGPLVQSEVTTRVEKPYTCDDCGKHFRWTSDLVRHQRTHTGEKPFFCTICSKSFS 511

  Fly   308 NKSMLNSHRKSHSSVYQYRCADC--------DYAT------------------KYCHS--FKLHL 344
            .||:|.:|::.|.....|.||:|        .|.|                  .:.||  |..||
Mouse   512 QKSVLTTHQRIHVGGKPYVCANCGENFSEQKQYLTHRKTHVSEEHHLCNECGRSFSHSAAFAKHL 576

  Fly   345 RKYGHKPGMVLDEDG 359
            :.:........||.|
Mouse   577 KGHASVRNCRCDECG 591

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hbNP_731267.1 C2H2 Zn finger 242..262 CDD:275368 4/19 (21%)
C2H2 Zn finger 271..291 CDD:275368 8/70 (11%)
zf-H2C2_2 283..308 CDD:290200 10/30 (33%)
C2H2 Zn finger 299..319 CDD:275368 7/19 (37%)
C2H2 Zn finger 327..345 CDD:275368 9/45 (20%)
C2H2 Zn finger 707..727 CDD:275371
C2H2 Zn finger 735..757 CDD:275371
Zfp202NP_109638.2 SCAN 43..153 CDD:128708 6/21 (29%)
KRAB 237..297 CDD:214630 9/59 (15%)
COG5048 <332..624 CDD:227381 59/262 (23%)
C2H2 Zn finger 393..413 CDD:275368 4/19 (21%)
C2H2 Zn finger 421..441 CDD:275368 2/19 (11%)
C2H2 Zn finger 475..495 CDD:275368 3/19 (16%)
C2H2 Zn finger 503..523 CDD:275368 7/19 (37%)
C2H2 Zn finger 531..551 CDD:275368 5/19 (26%)
C2H2 Zn finger 559..579 CDD:275368 5/19 (26%)
C2H2 Zn finger 587..607 CDD:275368 3/5 (60%)
C2H2 Zn finger 615..635 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167847298
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.