DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment hb and ZNF576

DIOPT Version :9

Sequence 1:	NP_731267.1	Gene:	hb / 41032	FlyBaseID:	FBgn0001180	Length:	758	Species:	Drosophila melanogaster
Sequence 2:	NP_001138819.1	Gene:	ZNF576 / 79177	HGNCID:	28357	Length:	170	Species:	Homo sapiens

Alignment Length:	81	Identity:	21/81 - (25%)
Similarity:	29/81 - (35%)	Gaps:	5/81 - (6%)

- Green bases have known domain annotations that are detailed below.

  Fly   679 SNSSSNGTTSAVAAPPSGTPAAAGAIYECKYCDIFFKDAVLYTIHMGYHSC---DDVFKCNMCGE 740
            ::..|:|..:....|.:.|  .|...:.|..|...|..||....|...|..   ...|.|..||:
Human    88 THQRSHGPAAKPTLPVATT--TAQPTFPCPDCGKTFGQAVSLRRHRQMHEVRAPPGTFACTECGQ 150

  Fly   741 KCDGPVGLFVHMARNA 756
            ......||..|..|:|
Human   151 DFAQEAGLHQHYIRHA 166

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
hb	NP_731267.1	C2H2 Zn finger	242..262	CDD:275368
		C2H2 Zn finger	271..291	CDD:275368
		zf-H2C2_2	283..308	CDD:290200
		C2H2 Zn finger	299..319	CDD:275368
		C2H2 Zn finger	327..345	CDD:275368
		C2H2 Zn finger	707..727	CDD:275371	6/19 (32%)
		C2H2 Zn finger	735..757	CDD:275371	8/22 (36%)
ZNF576	NP_001138819.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..29
		C2H2 Zn finger	36..53	CDD:275368
		C2H2 Zn finger	73..93	CDD:275368	0/4 (0%)
		zf-C2H2	112..134	CDD:306579	6/21 (29%)
		C2H2 Zn finger	114..134	CDD:275368	6/19 (32%)
		C2H2 Zn finger	145..165	CDD:275368	6/19 (32%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C165156881
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.930