DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hb and Zfp444

DIOPT Version :9

Sequence 1:NP_731267.1 Gene:hb / 41032 FlyBaseID:FBgn0001180 Length:758 Species:Drosophila melanogaster
Sequence 2:NP_001139496.1 Gene:Zfp444 / 72667 MGIID:1923365 Length:331 Species:Mus musculus


Alignment Length:268 Identity:60/268 - (22%)
Similarity:79/268 - (29%) Gaps:85/268 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   163 PVAVATGSSEKLQALTPPMDVT--PPKSPAKSSQSNIEPEKEHDQMSNSSEDMKYMAESEDDDTN 225
            |.....|||    |:..|.|||  |..|..|.....|       .:..||              .
Mouse   106 PATSPDGSS----AMRAPRDVTEGPGVSVGKEESGAI-------PLGTSS--------------G 145

  Fly   226 IRMPIYNSHGKMKNYK--------------------------CKTCGVVAITKVDFWAHTRTHMK 264
            ..:|...:.|.|:.||                          |..||...:.......|.::| .
Mouse   146 TEVPATENSGAMRPYKQEPGSPPPAPLAPVLPAFLAAPGTVSCPECGKSPLKPAHLLRHRQSH-S 209

  Fly   265 PDKILQCPKCPFVTEFKHHLEYHIRKH------------KNQKPFQCDKCSYTCVNKSMLNSHRK 317
            .:|...||:|......|.||..|...|            ..:||..|.:|..|...:..|..|||
Mouse   210 GEKPHACPECGKAFRRKEHLRRHRGTHPGSPGPALRPLPAREKPHACCECGKTFYWREHLVRHRK 274

  Fly   318 SHSSVYQYRCADCDYATKYCHSFKLHLRKYGHKPGMVLDEDGTPNPSLVIDVYGTRRGPKSKNGG 382
            :||....:.|.:|............|.|.:|....:.   .||..|           ||  :.||
Mouse   275 THSGARPFACWECGKGFGRREHVLRHQRIHGRAAAVA---QGTSAP-----------GP--EGGG 323

  Fly   383 ---PIASG 387
               |.|.|
Mouse   324 AFPPWALG 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hbNP_731267.1 C2H2 Zn finger 242..262 CDD:275368 4/19 (21%)
C2H2 Zn finger 271..291 CDD:275368 7/19 (37%)
zf-H2C2_2 283..308 CDD:290200 9/36 (25%)
C2H2 Zn finger 299..319 CDD:275368 7/19 (37%)
C2H2 Zn finger 327..345 CDD:275368 3/17 (18%)
C2H2 Zn finger 707..727 CDD:275371
C2H2 Zn finger 735..757 CDD:275371
Zfp444NP_001139496.1 SCAN 26..103 CDD:366881
COG5048 <186..>284 CDD:227381 25/98 (26%)
C2H2 Zn finger 188..208 CDD:275368 4/19 (21%)
C2H2 Zn finger 216..236 CDD:275368 7/19 (37%)
C2H2 Zn finger 256..276 CDD:275368 7/19 (37%)
zf-C2H2 282..304 CDD:333835 4/21 (19%)
C2H2 Zn finger 284..304 CDD:275368 4/19 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167847296
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.