DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hb and plagx

DIOPT Version :9

Sequence 1:NP_731267.1 Gene:hb / 41032 FlyBaseID:FBgn0001180 Length:758 Species:Drosophila melanogaster
Sequence 2:NP_001034918.1 Gene:plagx / 664689 ZFINID:ZDB-GENE-030131-839 Length:380 Species:Danio rerio


Alignment Length:395 Identity:88/395 - (22%)
Similarity:130/395 - (32%) Gaps:129/395 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   234 HGK-------------MKNYKCKTCGVVAITKVDFWAHTRTH-MKPDKILQCPKCPFVTEFKHHL 284
            |||             .:..:|:.||....|::....|..|| ......|.|..|..|.|....|
Zfish     3 HGKDQLNGHLQTHDPNKQELRCEECGKHYNTRLGLRRHVATHATSASSDLTCKVCRQVFESMPAL 67

  Fly   285 EYHIRKHKNQKP---------FQCDKCSYTCVNKSMLNSHRKSHSSVYQYRCADC-------DYA 333
            ..|:..|..:.|         .||::|......:..:..|...|:....:.|..|       |:.
Zfish    68 LEHLSTHTGRPPPGTVVRERKHQCERCGRRFFTRKDVRRHAVVHTGRRDFLCPRCAQRFGRRDHL 132

  Fly   334 TKYCHSFKLHLRKYGHKPGMVLDEDGTP------NPSLVIDVYG----TRRGPKSKNGGPIASGG 388
            |:  |..|.|.::....|.:.:.|:.:|      :|..|.:.:.    ..:|.:|.:...::...
Zfish   133 TR--HLKKSHAQELDALPTLPIKEEPSPTMCSVGSPKDVTEAFPMAMFNSQGLQSASTSGVSHHH 195

  Fly   389 SG--SGSRKSNVA--------AVAPQQQQSQPA-QPVA-TSQLSAALQGF-------PL------ 428
            .|  ||...|.|.        ...|||.|..|. ||.: ||.|.|.::.|       |:      
Zfish   196 HGMVSGPLSSPVGMGCYLEPNKPPPQQYQQTPRYQPSSTTSYLKAEMENFLTELQCGPMPPQAAV 260

  Fly   429 --------------VQGNSA-------------PPAASPVLPL------------PASPAKSVAS 454
                          :.|.||             |||:|..:.|            |.|.....::
Zfish   261 ATAVSRPGDLLPESLGGQSAHFTLRNSAFTSAEPPASSANMDLSHLLGFLPFGLPPYSTPLGYST 325

  Fly   455 VEQTPSL-PSPANLLP-PLASLLQQNRNMAFFPYWNLNLQMLAAQQQAAVLAQLS------PRMR 511
            ....|:: |||.:.|. ||.|         |.|      |.|...|.|..|.|||      ||..
Zfish   326 TSAAPAVSPSPTSQLSGPLTS---------FQP------QSLHEPQAAGHLNQLSGFSPTLPRFH 375

  Fly   512 EQLQQ 516
            :..||
Zfish   376 QAFQQ 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hbNP_731267.1 C2H2 Zn finger 242..262 CDD:275368 5/19 (26%)
C2H2 Zn finger 271..291 CDD:275368 6/19 (32%)
zf-H2C2_2 283..308 CDD:290200 7/33 (21%)
C2H2 Zn finger 299..319 CDD:275368 3/19 (16%)
C2H2 Zn finger 327..345 CDD:275368 7/24 (29%)
C2H2 Zn finger 707..727 CDD:275371
C2H2 Zn finger 735..757 CDD:275371
plagxNP_001034918.1 C2H2 Zn finger 54..74 CDD:275368 6/19 (32%)
C2H2 Zn finger 91..111 CDD:275368 3/19 (16%)
C2H2 Zn finger 119..137 CDD:275368 5/19 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592556
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.