DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hb and PRDM15

DIOPT Version :9

Sequence 1:NP_731267.1 Gene:hb / 41032 FlyBaseID:FBgn0001180 Length:758 Species:Drosophila melanogaster
Sequence 2:XP_011527985.1 Gene:PRDM15 / 63977 HGNCID:13999 Length:1441 Species:Homo sapiens


Alignment Length:410 Identity:79/410 - (19%)
Similarity:132/410 - (32%) Gaps:127/410 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   234 HGKMKNYKCKTCGVVAITKVDFWAHTRTHMKPDKILQCPKCPFVTEFKHHLEYHIRKHKNQKPFQ 298
            |..::.|.|..||....||.....|.:.| |..|..:|.:|......|.::..|.::|...|.|.
Human  1040 HDNVREYLCAECGKGMKTKHALRHHMKLH-KGIKEYECKECHRRFAQKVNMLKHCKRHTGIKDFM 1103

  Fly   299 CDKCSYTCVNKSMLNSHRKSHSSVYQYRCADCD--YATKY-----------------CH------ 338
            |:.|..|...::.:.:|:..|:...|:.|:.||  |.|:|                 |.      
Human  1104 CELCGKTFSERNTMETHKLIHTVGKQWTCSVCDKKYVTEYMLQKHVQLTHDKVEAQSCQLCGTKV 1168

  Fly   339 ----SFKLHLRK------------YGHKP-GMVLDED--GTPNPSLVIDVYGTRRG--------- 375
                |...|:|:            ..|.| ...:|..  |...|.|.::......|         
Human  1169 STRASMSRHMRRKHPEVLAVRIDDLDHLPETTTIDASSIGIVQPELTLEQEDLAEGKHGKAAKRS 1233

  Fly   376 ------PKSKNGGPIASGG------------SGSGSRKSNVAAVAPQQ--------QQSQPAQPV 414
                  |:.:.|.|:....            :||...::|.|..:.||        ..:.|:..|
Human  1234 HKRKQKPEEEAGAPVPEDATFSEYSEKETEFTGSVGDETNSAVQSIQQVVVTLGDPNVTTPSSSV 1298

  Fly   415 ATSQL------SAALQGF----PLVQGNSAPPAA-----SPVLPL-------------------- 444
            ..:.:      :||...|    |:..|:...|..     :.:|.:                    
Human  1299 GLTNITVTPITTAAATQFTNLQPVAVGHLTTPERQLQLDNSILTVTFDTVSGSAMLHNRQNDVQI 1363

  Fly   445 -PASPAKSVASVEQTPSLPSPANLLPPLASLLQQNRNMAFFPYWNLNLQMLAAQQQAAVLAQLSP 508
             |...|.:..||....:|.:..|.:.||.|.|.....:.    |.       |..|..||....|
Human  1364 HPQPEASNPQSVAHFINLTTLVNSITPLGSQLSDQHPLT----WR-------AVPQTDVLPPSQP 1417

  Fly   509 RMREQLQQQNQQQSDNEEEE 528
            :...|...|.|.|::.::::
Human  1418 QAPPQQAAQPQVQAEQQQQQ 1437

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hbNP_731267.1 C2H2 Zn finger 242..262 CDD:275368 6/19 (32%)
C2H2 Zn finger 271..291 CDD:275368 4/19 (21%)
zf-H2C2_2 283..308 CDD:290200 7/24 (29%)
C2H2 Zn finger 299..319 CDD:275368 4/19 (21%)
C2H2 Zn finger 327..345 CDD:275368 9/46 (20%)
C2H2 Zn finger 707..727 CDD:275371
C2H2 Zn finger 735..757 CDD:275371
PRDM15XP_011527985.1 SET 349..465 CDD:214614
GAGA_bind <515..>580 CDD:283799
COG5048 663..1125 CDD:227381 22/85 (26%)
zf-C2H2 672..694 CDD:278523
C2H2 Zn finger 674..694 CDD:275368
C2H2 Zn finger 701..722 CDD:275368
C2H2 Zn finger 735..751 CDD:275368
C2H2 Zn finger 789..809 CDD:275368
C2H2 Zn finger 838..858 CDD:275368
C2H2 Zn finger 865..885 CDD:275368
C2H2 Zn finger 928..949 CDD:275370
C2H2 Zn finger 956..976 CDD:275368
C2H2 Zn finger 992..1012 CDD:275368
zf-H2C2_2 1004..1029 CDD:290200
C2H2 Zn finger 1020..1040 CDD:275368 79/410 (19%)
C2H2 Zn finger 1048..1068 CDD:275368 6/19 (32%)
zf-H2C2_2 1060..1085 CDD:290200 6/25 (24%)
C2H2 Zn finger 1076..1096 CDD:275368 4/19 (21%)
C2H2 Zn finger 1104..1124 CDD:275368 4/19 (21%)
C2H2 Zn finger 1132..1153 CDD:275368 6/20 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.