DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hb and ikzf5

DIOPT Version :9

Sequence 1:NP_731267.1 Gene:hb / 41032 FlyBaseID:FBgn0001180 Length:758 Species:Drosophila melanogaster
Sequence 2:XP_012822117.1 Gene:ikzf5 / 550109 XenbaseID:XB-GENE-978531 Length:453 Species:Xenopus tropicalis


Alignment Length:600 Identity:129/600 - (21%)
Similarity:197/600 - (32%) Gaps:232/600 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   192 SSQSNIEPE------KEHDQMSNSSEDMKYMAESEDDDTN------IRMPIYNSHGKMKN----- 239
            |..|:.|.|      :.||.:|.:|..:...|...|.|.|      :.:.:..|.|.:.:     
 Frog    32 SVSSDKEAETLQGGTQNHDALSANSPCLALPAAGTDSDQNGLDHPSVEVSLDESAGMLVDGFERT 96

  Fly   240 ----YKCKTCGVVAITKVDFWAHTRTHM--KPDKILQCPKCPFVTEFKHHLEYHIRKHKNQKPFQ 298
                .||:.|...:........|.|.|.  ||.:   |..|||.:.::.|||.|:|.|..:||::
 Frog    97 FDGKLKCRYCNYASKGTARLIEHIRIHTGEKPHR---CHLCPFASAYERHLEAHMRSHTGEKPYK 158

  Fly   299 CDKCSYTCVNKSMLNSHRKSHSSVYQYRCADCDYATKYCHSFKLHLRKYGHKPGMVLDEDGTPNP 363
            |:.||:.|.::|.|:.||:                           ||  ||   :|...|| .|
 Frog   159 CELCSFRCSDRSNLSHHRR---------------------------RK--HK---MLPIKGT-RP 190

  Fly   364 SLVIDVYGTRRGPKSKNGGPIASGGSGSG-SRKSNVAAVAPQQQQSQPAQPVATSQLSAALQGFP 427
            ||         |.| |..|.:....|..| :|::.:                             
 Frog   191 SL---------GNK-KMWGVLQKKVSSLGYTRRTLI----------------------------- 216

  Fly   428 LVQGNSAPPAASPVLPLPASPAKSVASVEQTPSLPSPANLLPPLASLLQQNRNMAFFPYWNLNLQ 492
                |.:||:.     :...|........:.||:.|.|                         .:
 Frog   217 ----NLSPPSM-----VVHKPDYLSDFAHEIPSIQSEA-------------------------YE 247

  Fly   493 MLAAQQQAAVLAQLSPRMREQLQQQNQQQSDNEEEEQDDEYERKSVDSAMDLSQGTPVKEDEQQQ 557
            .||....:.||:                                                    :
 Frog   248 SLAKASHSGVLS----------------------------------------------------R 260

  Fly   558 QPQQPLAMNLKVEEEATPLMSSSNASRRKGRVLKLDTLLQLRSEAMTSPEQLKVPSTPMPTASSP 622
            .||:.:..|                        .|:.|..|..:..:.|...:.|::|   .:.|
 Frog   261 DPQELMVDN------------------------PLNQLSTLAGQLSSLPPDTQNPASP---DTGP 298

  Fly   623 IAGRKPM-----PEEHCSGTSSADESMETAHVPQANTSASSTASSSGNSSNASSNSNGNSSSNSS 682
            ....||.     |...|:...|..       |.|:::.||.....:.|..|.|..: |.||..|.
 Frog   299 CPDEKPFMIQQPPPPACASAVSTS-------VAQSSSPASPEGRPTHNHRNCSPMA-GPSSERSG 355

  Fly   683 SNGTTSAVAAPPSGTPAAA------GAIYECKYCDIFFKDAVLYTIHMGYHSCDDVFKCNMCGEK 741
            ...|.|...:.|| |||.|      ..::.|::||::|.|.:|||||||.|..::.|:||:||.|
 Frog   356 RTSTPSISNSQPS-TPAPALPAQDPQLLHHCQHCDMYFADNILYTIHMGCHGFENPFQCNICGCK 419

  Fly   742 CDGPVGLFVHMARNA 756
            |........|.||.|
 Frog   420 CKNKYDFACHFARGA 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hbNP_731267.1 C2H2 Zn finger 242..262 CDD:275368 4/19 (21%)
C2H2 Zn finger 271..291 CDD:275368 9/19 (47%)
zf-H2C2_2 283..308 CDD:290200 12/24 (50%)
C2H2 Zn finger 299..319 CDD:275368 8/19 (42%)
C2H2 Zn finger 327..345 CDD:275368 0/17 (0%)
C2H2 Zn finger 707..727 CDD:275371 12/19 (63%)
C2H2 Zn finger 735..757 CDD:275371 9/21 (43%)
ikzf5XP_012822117.1 C2H2 Zn finger 103..123 CDD:275368 4/19 (21%)
zf-H2C2_2 115..140 CDD:404364 9/27 (33%)
C2H2 Zn finger 131..151 CDD:275368 9/19 (47%)
zf-H2C2_2 143..167 CDD:404364 11/23 (48%)
C2H2 Zn finger 159..177 CDD:275368 7/17 (41%)
PHA02682 <286..>384 CDD:177464 27/109 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 143 1.000 Inparanoid score I4366
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264318at33208
OrthoFinder 1 1.000 - - FOG0003075
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.060

Return to query results.
Submit another query.