DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hb and CG12071

DIOPT Version :9

Sequence 1:NP_731267.1 Gene:hb / 41032 FlyBaseID:FBgn0001180 Length:758 Species:Drosophila melanogaster
Sequence 2:NP_651832.3 Gene:CG12071 / 43660 FlyBaseID:FBgn0039808 Length:581 Species:Drosophila melanogaster


Alignment Length:698 Identity:137/698 - (19%)
Similarity:230/698 - (32%) Gaps:253/698 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 QFLKQQQQQLQQQPMDTLCAMTPSPSQNDQNSLQHYDANLQQQLLQQQQYQQHFQAAQQQHHHHH 121
            || ||||...||.          ||:.|:.|:.|: :.|:|||..||||.||..|..|||.|   
  Fly    29 QF-KQQQTSQQQN----------SPTANNNNNSQN-NGNMQQQQQQQQQQQQQQQQQQQQQH--- 78

  Fly   122 HLMGGFNPLTPPGLPNPMQHFYGGNLRPSPQPTPTSASTIAPVAVATGSSEKLQALTPPMDVTPP 186
                                 |...:: .||   .|:|.:|  |.|.|.|    ..|.|.|....
  Fly    79 ---------------------YAATIK-VPQ---ISSSNVA--AAAAGES----TFTVPDDGMGF 112

  Fly   187 KSPAKSSQS------------NI---------EPEKEHDQMSNSSEDMKYMAESEDDDTNIRM-- 228
            :...:..||            ||         ||..|...|..:|. :|.:.:.:...:.:|.  
  Fly   113 EGGVRVLQSLGTWSAAEQLTYNIPKPNLIPFTEPYVEGGSMHPASR-LKALQQVQQASSGVRKTN 176

  Fly   229 PIYNSHGKMKNYKCKTCGVVAITKVDFWAHTRTHMKPDKILQCPKCPFVTEFKHHLEYHIRKHKN 293
            |   |....|.::|..||             :...:.||                |..|:|.|..
  Fly   177 P---SKSTNKAFECTVCG-------------KGLARKDK----------------LTIHMRIHTG 209

  Fly   294 QKPFQCDKCSYTCVNKSMLNSHRKSHSSVYQYRCADCDYATKYCHSFKLHLRKYGHKPGMVLDED 358
            :||:.|:.|:.....:..|                            .:|:.|:.|.        
  Fly   210 EKPYICEVCNKAFARRDKL----------------------------VIHMNKFKHV-------- 238

  Fly   359 GTPNPSLVIDVYGTRRGPKSKNGGPIASGGSGSGSRKSNVAAVAPQQQQSQPAQPVATSQLSAAL 423
             ||.                 |..|:       |.|.:|:.     :::.||..|...::.|..|
  Fly   239 -TPT-----------------NIAPL-------GKRLNNMV-----KKKEQPDPPPEDNKQSLEL 273

  Fly   424 Q----------GFPLVQGNSAPPAASPVLPLP--------------------------------- 445
            |          ...:||.....|.:.|.:.:|                                 
  Fly   274 QLQQQAVQVAAQNIIVQSAQGAPTSIPGIIIPHHQQQLSWTCELCGRMFSSRDEWSIHAKSHLEY 338

  Fly   446 ASPAKSVASVEQTPSLPSPANLLPPLASLLQQNRNMAFFPYWNLNLQMLAAQQQAAVLAQ----- 505
            ..|.:.||  |.|....:.|.::....| ...:||.......| .:||.|..::..::.|     
  Fly   339 XQPERLVA--ESTKPAAAAAGVIAKTTS-SNNSRNYQMDANQN-QIQMEAQARKQKIIIQNQMIL 399

  Fly   506 -LSPRMREQLQQQNQQQSDNEEEEQDDEYERKSVDSAMDLSQGTPVKEDEQQQQPQQPLAMNLKV 569
             .|.:.::|.||..|||...::::|...:.:|:........|....::.:||||.||      :.
  Fly   400 NASHQQQQQPQQHPQQQQHQQQQQQHVAHGKKAARKHQQHLQQQQQQQQQQQQQQQQ------QQ 458

  Fly   570 EEEATPLMSSSNASRRKGRVLKLDTLLQLRSEAMTSPEQLKVPSTPMPTASSPIAG--RKPMPEE 632
            ::.:.|:.:::::|...|.               ...:::.||.:.: .|:||.|.  .:....|
  Fly   459 QQTSAPMYNNNSSSNHNGN---------------NQSQEVSVPVSHI-IANSPTAATYMQAQLSE 507

  Fly   633 HCSG--------TSSADESMETAHVPQANTSASSTASSSGNSSNASSN 672
            |.|.        |.:.::.......|..:..|.......|:::..::|
  Fly   508 HASNMQHGMPIVTYNGNQYCVITRAPDLDVEAMQKPLDYGHAAGGATN 555

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hbNP_731267.1 C2H2 Zn finger 242..262 CDD:275368 3/19 (16%)
C2H2 Zn finger 271..291 CDD:275368 3/19 (16%)
zf-H2C2_2 283..308 CDD:290200 8/24 (33%)
C2H2 Zn finger 299..319 CDD:275368 3/19 (16%)
C2H2 Zn finger 327..345 CDD:275368 1/17 (6%)
C2H2 Zn finger 707..727 CDD:275371
C2H2 Zn finger 735..757 CDD:275371
CG12071NP_651832.3 zf-C2H2 185..207 CDD:278523 8/50 (16%)
C2H2 Zn finger 187..207 CDD:275368 8/48 (17%)
zf-H2C2_2 200..224 CDD:290200 8/23 (35%)
C2H2 Zn finger 215..232 CDD:275368 3/44 (7%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24393
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.