DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hb and CG7691

DIOPT Version :9

Sequence 1:NP_731267.1 Gene:hb / 41032 FlyBaseID:FBgn0001180 Length:758 Species:Drosophila melanogaster
Sequence 2:NP_650728.1 Gene:CG7691 / 42228 FlyBaseID:FBgn0038626 Length:283 Species:Drosophila melanogaster


Alignment Length:279 Identity:58/279 - (20%)
Similarity:86/279 - (30%) Gaps:114/279 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 NLRPSPQPTPTSASTIA------------------------------PVAVATGSSEKL--QALT 178
            ||.|.|:|.....|.:|                              |:.|.....|:|  |.: 
  Fly    33 NLPPMPRPKTNHHSRVATKPEPKTNVKFTYCFGQSEPSGDWRQGDDIPIVVRREMEERLGIQLM- 96

  Fly   179 PPMDVTPPKSPAKSSQSNIEPEKEHDQMSNSSEDMKYMAESEDDDTNIRMPIYNSHGKMKNYKCK 243
                             ::.|..|...:|::..::|...||.|.....|..|             
  Fly    97 -----------------SVLPITESSLLSHTIWELKMPGESFDSIPKTRNGI------------- 131

  Fly   244 TCGVVAITKVDFWAHTRTHMK-----------PDKILQCP-----KCP----------------F 276
            ..|::.:|...  ..|||.:|           |..|::.|     |.|                .
  Fly   132 KVGIITVTAES--KQTRTKLKRKGPILANVTVPSNIVEIPPIQQRKMPEKRRLKRVGGQFECIDC 194

  Fly   277 VTEFKHH--LEYHIRKHKNQKPFQC--DKCSYTCVNKSMLNSHRKS--HSSVYQYRCADCDYATK 335
            ..:|.|.  |..|.|.|..:|||.|  ..|.....::|.|.||:::  |.. :|::|..|.   |
  Fly   195 DKKFDHSWMLTAHTRTHTGEKPFVCPDGSCRKAFSDRSNLRSHQRTMGHHE-WQHQCGQCG---K 255

  Fly   336 YCHSFKL---H----LRKY 347
            |...|..   |    .|||
  Fly   256 YFSQFSYLNRHSLDACRKY 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hbNP_731267.1 C2H2 Zn finger 242..262 CDD:275368 4/19 (21%)
C2H2 Zn finger 271..291 CDD:275368 8/42 (19%)
zf-H2C2_2 283..308 CDD:290200 9/28 (32%)
C2H2 Zn finger 299..319 CDD:275368 6/23 (26%)
C2H2 Zn finger 327..345 CDD:275368 6/24 (25%)
C2H2 Zn finger 707..727 CDD:275371
C2H2 Zn finger 735..757 CDD:275371
CG7691NP_650728.1 COG5048 188..>271 CDD:227381 23/86 (27%)
C2H2 Zn finger 191..211 CDD:275368 5/19 (26%)
zf-H2C2_2 203..229 CDD:290200 9/25 (36%)
C2H2 Zn finger 219..244 CDD:275368 6/24 (25%)
C2H2 Zn finger 250..266 CDD:275368 5/18 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24393
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.