Sequence 1: | NP_731267.1 | Gene: | hb / 41032 | FlyBaseID: | FBgn0001180 | Length: | 758 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_650728.1 | Gene: | CG7691 / 42228 | FlyBaseID: | FBgn0038626 | Length: | 283 | Species: | Drosophila melanogaster |
Alignment Length: | 279 | Identity: | 58/279 - (20%) |
---|---|---|---|
Similarity: | 86/279 - (30%) | Gaps: | 114/279 - (40%) |
- Green bases have known domain annotations that are detailed below.
Fly 146 NLRPSPQPTPTSASTIA------------------------------PVAVATGSSEKL--QALT 178
Fly 179 PPMDVTPPKSPAKSSQSNIEPEKEHDQMSNSSEDMKYMAESEDDDTNIRMPIYNSHGKMKNYKCK 243
Fly 244 TCGVVAITKVDFWAHTRTHMK-----------PDKILQCP-----KCP----------------F 276
Fly 277 VTEFKHH--LEYHIRKHKNQKPFQC--DKCSYTCVNKSMLNSHRKS--HSSVYQYRCADCDYATK 335
Fly 336 YCHSFKL---H----LRKY 347 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
hb | NP_731267.1 | C2H2 Zn finger | 242..262 | CDD:275368 | 4/19 (21%) |
C2H2 Zn finger | 271..291 | CDD:275368 | 8/42 (19%) | ||
zf-H2C2_2 | 283..308 | CDD:290200 | 9/28 (32%) | ||
C2H2 Zn finger | 299..319 | CDD:275368 | 6/23 (26%) | ||
C2H2 Zn finger | 327..345 | CDD:275368 | 6/24 (25%) | ||
C2H2 Zn finger | 707..727 | CDD:275371 | |||
C2H2 Zn finger | 735..757 | CDD:275371 | |||
CG7691 | NP_650728.1 | COG5048 | 188..>271 | CDD:227381 | 23/86 (27%) |
C2H2 Zn finger | 191..211 | CDD:275368 | 5/19 (26%) | ||
zf-H2C2_2 | 203..229 | CDD:290200 | 9/25 (36%) | ||
C2H2 Zn finger | 219..244 | CDD:275368 | 6/24 (25%) | ||
C2H2 Zn finger | 250..266 | CDD:275368 | 5/18 (28%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR24393 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |