DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hb and Zfp174

DIOPT Version :9

Sequence 1:NP_731267.1 Gene:hb / 41032 FlyBaseID:FBgn0001180 Length:758 Species:Drosophila melanogaster
Sequence 2:NP_001074686.1 Gene:Zfp174 / 385674 MGIID:2686600 Length:407 Species:Mus musculus


Alignment Length:306 Identity:66/306 - (21%)
Similarity:110/306 - (35%) Gaps:46/306 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 DGNSVASSPRQSPIPSTNHLEQFLKQQQQQLQQQPMDTLCAMTPS----------PS---QNDQN 87
            |.:..:..|:|.........:..|::...||.:|.:......|||          ||   .::|.
Mouse   123 DLHRTSKKPKQWVTVCMQGQKVLLEKTGAQLVEQELRDFQPQTPSRDIQEDSLEEPSCEGSHEQL 187

  Fly    88 SLQHYDAN-LQQQLLQQQQYQQHFQAAQQQHHHHHHLMGGFNPLTPPGLPNPMQHFYGGNLRPSP 151
            |..|::.. ||:.:|:..:.:.......:::.......|........|.|.      ||.|. ||
Mouse   188 SPHHWEKTVLQEPVLRLTETESSRMRGDKENPKQEEARGAKACTVLHGRPK------GGTLH-SP 245

  Fly   152 QPTPTSASTIAPVAVATGSSEKLQALTPPMDVTPPKSPAKSSQSNIEPEKEHDQMSN--SSEDMK 214
            :|...:||          .:..||     ..|.||:|| ||.....:..:|.:.:||  ....::
Mouse   246 EPRGVTAS----------DARLLQ-----WQVRPPQSP-KSLAHYQKHCRELEYISNPLRGHPLR 294

  Fly   215 YMAESEDDDTNIRMPIYN------SHGKMKNYKCKTCGVVAITKVDFWAHTRTHMKPDKILQCPK 273
            .:..|..........:..      :|...|.|.|:.||.......:...|.|.| ..::...|.:
Mouse   295 ELKRSRGGRRRSLSGLLQCLGHQAAHPAKKPYSCEDCGKNFTWNSELKRHRRVH-TGERPYICGE 358

  Fly   274 CPFVTEFKHHLEYHIRKHKNQKPFQCDKCSYTCVNKSMLNSHRKSH 319
            |......:..|:.|.|.|..:||:||..|.......|.|:.|.:.|
Mouse   359 CGNCFGRQSTLKLHQRIHTGEKPYQCSHCGKCFRQSSNLHQHHRLH 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hbNP_731267.1 C2H2 Zn finger 242..262 CDD:275368 5/19 (26%)
C2H2 Zn finger 271..291 CDD:275368 5/19 (26%)
zf-H2C2_2 283..308 CDD:290200 9/24 (38%)
C2H2 Zn finger 299..319 CDD:275368 5/19 (26%)
C2H2 Zn finger 327..345 CDD:275368
C2H2 Zn finger 707..727 CDD:275371
C2H2 Zn finger 735..757 CDD:275371
Zfp174NP_001074686.1 SCAN 42..152 CDD:128708 4/28 (14%)
SCAN 42..130 CDD:280241 1/6 (17%)
C2H2 Zn finger 328..348 CDD:275368 5/19 (26%)
zf-H2C2_2 340..365 CDD:290200 5/25 (20%)
COG5048 352..>407 CDD:227381 15/53 (28%)
C2H2 Zn finger 356..376 CDD:275368 5/19 (26%)
zf-H2C2_2 369..393 CDD:290200 9/23 (39%)
C2H2 Zn finger 384..404 CDD:275368 5/19 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167847295
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.