DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hb and MESR4

DIOPT Version :9

Sequence 1:NP_731267.1 Gene:hb / 41032 FlyBaseID:FBgn0001180 Length:758 Species:Drosophila melanogaster
Sequence 2:NP_001097359.1 Gene:MESR4 / 36986 FlyBaseID:FBgn0034240 Length:2171 Species:Drosophila melanogaster


Alignment Length:611 Identity:123/611 - (20%)
Similarity:208/611 - (34%) Gaps:191/611 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 IAPVAVATGSSEKLQALTPPMDVTPPKSPAKSSQSNIEPEKEHDQMSNSSEDMKYMAESEDDDTN 225
            |.|..|| ||...||......|:.|..|   :.:..:...|:|.......||.:           
  Fly  1177 ICPGEVA-GSVYDLQFRCCLCDMAPLPS---AFRLMVHLRKQHQACDICLEDCQ----------- 1226

  Fly   226 IRMPIYNSHGKMKN--------YKCKTCGVVAITKVD-----FWAHTRTHMKPDKILQ------- 270
                   |..|:.:        :.|..||:....|.|     ||.|........:.||       
  Fly  1227 -------SQSKLSSHVWKHKLLHLCYRCGIAYRNKQDISKHLFWKHGTESAGCKQCLQKRWRHVY 1284

  Fly   271 ----------CPKCPFVTEFKHHLEYHIRKHKNQKPFQC--DKCSYTCVNKSMLNSHRKSH---- 319
                      |.:|.||.....:||.|.|.|.....:.|  :.|....|::.:|..|..||    
  Fly  1285 HFCVPPAEFPCEQCGFVFSKAIYLEVHQRMHTGDFRYACTEEGCEEKFVSRKLLLKHASSHVAKE 1349

  Fly   320 --SSVYQYRCADCDYATKYCHSFKLHL------RKYGHKPGMVLDEDGTPNPSLVIDVYGTRRGP 376
              .:|...:.||. ..|:.....|..|      ::..|....:|.|..|.|.:           |
  Fly  1350 LPQAVSVEQTADA-APTEKLEDIKEELEEGEDEKEGAHNQEKLLSESLTNNET-----------P 1402

  Fly   377 KSKNGG--------PIASGGSGSGSRKS--------NVAAVAPQQQQSQPAQPVATSQLSAALQG 425
            |.:...        |::...:....:||        ::..:||...:|..:.             
  Fly  1403 KKEESDRIDNSIEPPLSKSENRKRRKKSKRNKESLEDLNLIAPNLSESDSSD------------- 1454

  Fly   426 FPLVQGNSAPPAAS----PVLPLPASPAKSVASVEQTPSLPSPANLLPPLASLLQQNRNMAFFPY 486
                ..:|..|.:|    |.||:.:|          ...|..|..:|.|                
  Fly  1455 ----DSDSDAPRSSHQEQPKLPMRSS----------VDDLDMPKVMLSP---------------- 1489

  Fly   487 WNLNLQMLAAQQQAAVLAQLSPRMREQLQQQNQQQSDNEEEEQ----DDEYERKSVDSAMDLSQG 547
                    :::..|..|..     :.:|:.:.::..|...||:    |||.|.|..:..:|:|..
  Fly  1490 --------SSESDADELDG-----KSKLEDKEEKPLDGSTEEKALDADDELEPKKEEDQVDVSIW 1541

  Fly   548 TPVKEDEQQQQPQQPLAMNLKVEEEATPLMSSSNASRRKGRVLKLDTLLQLRSEAMTSPEQLKVP 612
            ..:.:::....|::   ..:|.||....|::...|        ||..       |.:..:..|:.
  Fly  1542 KNLLQNQAVAIPEE---QAVKDEEREDSLVNLPPA--------KLHV-------AWSDHDYCKLY 1588

  Fly   613 STPMPTASSPIAGRKPMPEEHCSGTSSADESMETAHVPQANTSASSTASSSGNSSNASSNSNGNS 677
            .||.|   ||:..:            ||::|........|::.:.|::|||.:.|::||.|.|::
  Fly  1589 RTPAP---SPVKQK------------SANKSSIKTPGENASSDSDSSSSSSSSDSDSSSCSCGSN 1638

  Fly   678 SSNSSSNGTTSAVAAPPSGTPAAAGA 703
            .|.||||.::|:..:..|.:..|.|:
  Fly  1639 CSCSSSNSSSSSGNSDDSDSSTARGS 1664

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hbNP_731267.1 C2H2 Zn finger 242..262 CDD:275368 8/24 (33%)
C2H2 Zn finger 271..291 CDD:275368 8/19 (42%)
zf-H2C2_2 283..308 CDD:290200 7/26 (27%)
C2H2 Zn finger 299..319 CDD:275368 5/21 (24%)
C2H2 Zn finger 327..345 CDD:275368 5/23 (22%)
C2H2 Zn finger 707..727 CDD:275371
C2H2 Zn finger 735..757 CDD:275371
MESR4NP_001097359.1 C2H2 Zn finger 1272..1288 CDD:275368 2/15 (13%)
C2H2 Zn finger 1295..1315 CDD:275370 8/19 (42%)
C2H2 Zn finger 1323..1341 CDD:275370 4/17 (24%)
PHD_ING 2110..2156 CDD:276980
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24393
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.