Sequence 1: | NP_731267.1 | Gene: | hb / 41032 | FlyBaseID: | FBgn0001180 | Length: | 758 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_609786.2 | Gene: | CG17328 / 34962 | FlyBaseID: | FBgn0028895 | Length: | 413 | Species: | Drosophila melanogaster |
Alignment Length: | 260 | Identity: | 60/260 - (23%) |
---|---|---|---|
Similarity: | 91/260 - (35%) | Gaps: | 87/260 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 143 YGGNLRPSPQPTPTSASTI-APVAVATGSSEKLQALTPPMDVTPPKSPAKSSQSNIEPEKEHDQM 206
Fly 207 SNSSEDMKYMAESEDDDTNIRMP--IYNSHGKMKNYKCKTCGVVAITKVDFWAHTRTHMKPDKIL 269
Fly 270 QCPKCPFVTEF--KHHLEYHIRKHKNQKPFQCDKCS----------------------------- 303
Fly 304 --YTCVNKSMLNSHRKSHSSVYQYRCADC--------DYATKYCHSFKLHLRKYGHKPGMVLDED 358
Fly 359 358 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
hb | NP_731267.1 | C2H2 Zn finger | 242..262 | CDD:275368 | 4/19 (21%) |
C2H2 Zn finger | 271..291 | CDD:275368 | 7/21 (33%) | ||
zf-H2C2_2 | 283..308 | CDD:290200 | 13/55 (24%) | ||
C2H2 Zn finger | 299..319 | CDD:275368 | 7/50 (14%) | ||
C2H2 Zn finger | 327..345 | CDD:275368 | 8/25 (32%) | ||
C2H2 Zn finger | 707..727 | CDD:275371 | |||
C2H2 Zn finger | 735..757 | CDD:275371 | |||
CG17328 | NP_609786.2 | zf-AD | 8..80 | CDD:214871 | |
COG5048 | 146..>211 | CDD:227381 | 28/79 (35%) | ||
C2H2 Zn finger | 149..169 | CDD:275368 | 8/31 (26%) | ||
C2H2 Zn finger | 177..197 | CDD:275368 | 7/21 (33%) | ||
zf-H2C2_2 | 189..213 | CDD:404364 | 11/23 (48%) | ||
C2H2 Zn finger | 205..225 | CDD:275368 | 3/19 (16%) | ||
C2H2 Zn finger | 233..253 | CDD:275368 | 4/22 (18%) | ||
zf-H2C2_2 | 245..270 | CDD:404364 | 5/27 (19%) | ||
C2H2 Zn finger | 261..282 | CDD:275368 | 6/23 (26%) | ||
C2H2 Zn finger | 318..338 | CDD:275368 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR24393 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |