DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hb and CG17328

DIOPT Version :9

Sequence 1:NP_731267.1 Gene:hb / 41032 FlyBaseID:FBgn0001180 Length:758 Species:Drosophila melanogaster
Sequence 2:NP_609786.2 Gene:CG17328 / 34962 FlyBaseID:FBgn0028895 Length:413 Species:Drosophila melanogaster


Alignment Length:260 Identity:60/260 - (23%)
Similarity:91/260 - (35%) Gaps:87/260 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 YGGNLRPSPQPTPTSASTI-APVAVATGSSEKLQALTPPMDVTPPKSPAKSSQSNIEPEKEHDQM 206
            |.|.|....|...|:...: .|:.....|.|:     .|:|.   |...:.|:...:|.:||.:.
  Fly    81 YLGILESWRQDAATNTDFVEKPLLPQRDSDEE-----EPVDA---KVSKRRSRYQRKPPEEHKKR 137

  Fly   207 SNSSEDMKYMAESEDDDTNIRMP--IYNSHGKMKNYKCKTCGVVAITKVDFWAHTRTHMKPDKIL 269
            ......              :||  .|..|   |::||    :..:|:     |.||| ..:|..
  Fly   138 GPKPVP--------------KMPHTCYECH---KSFKC----IAQLTQ-----HIRTH-TGEKPY 175

  Fly   270 QCPKCPFVTEF--KHHLEYHIRKHKNQKPFQCDKCS----------------------------- 303
            ||..|  :..|  |::|:.|.|.|...|||||:.||                             
  Fly   176 QCSFC--IQRFAQKYNLKVHERTHTGDKPFQCEICSKQFSALGNFQAHQKIHLGVRDQVCSLCQK 238

  Fly   304 --YTCVNKSMLNSHRKSHSSVYQYRCADC--------DYATKYCHSFKLHLRKYGHKPGMVLDED 358
              ||..:   |:.|..:|:.:..:.|..|        |..|   |..|||..:......:|.|:|
  Fly   239 GFYTAGD---LSKHMITHTGIKNHHCDVCGKAFSRRRDMRT---HKLKLHPLESSTNHDIVDDDD 297

  Fly   359  358
              Fly   298  297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hbNP_731267.1 C2H2 Zn finger 242..262 CDD:275368 4/19 (21%)
C2H2 Zn finger 271..291 CDD:275368 7/21 (33%)
zf-H2C2_2 283..308 CDD:290200 13/55 (24%)
C2H2 Zn finger 299..319 CDD:275368 7/50 (14%)
C2H2 Zn finger 327..345 CDD:275368 8/25 (32%)
C2H2 Zn finger 707..727 CDD:275371
C2H2 Zn finger 735..757 CDD:275371
CG17328NP_609786.2 zf-AD 8..80 CDD:214871
COG5048 146..>211 CDD:227381 28/79 (35%)
C2H2 Zn finger 149..169 CDD:275368 8/31 (26%)
C2H2 Zn finger 177..197 CDD:275368 7/21 (33%)
zf-H2C2_2 189..213 CDD:404364 11/23 (48%)
C2H2 Zn finger 205..225 CDD:275368 3/19 (16%)
C2H2 Zn finger 233..253 CDD:275368 4/22 (18%)
zf-H2C2_2 245..270 CDD:404364 5/27 (19%)
C2H2 Zn finger 261..282 CDD:275368 6/23 (26%)
C2H2 Zn finger 318..338 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24393
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.