DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hb and Ikzf5

DIOPT Version :9

Sequence 1:NP_731267.1 Gene:hb / 41032 FlyBaseID:FBgn0001180 Length:758 Species:Drosophila melanogaster
Sequence 2:NP_001101025.1 Gene:Ikzf5 / 309031 RGDID:1310965 Length:419 Species:Rattus norvegicus


Alignment Length:609 Identity:136/609 - (22%)
Similarity:205/609 - (33%) Gaps:229/609 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 PMDVTPPKSPAKSSQSNIEPEKEHDQMSNSSEDMKYMAES-----EDDDTN------IRMPIYNS 233
            |:|.      .|..|..:..:..|..|.:.|......||:     .|.|.|      :.:.:..:
  Rat     8 PLDF------VKDFQEYLTQQTHHVNMISGSVSGDKEAETLQGAGTDGDQNGLDHPSVEVSLDEN 66

  Fly   234 HGKMKN---------YKCKTCGVVAITKVDFWAHTRTHM--KPDKILQCPKCPFVTEFKHHLEYH 287
            .|.:.:         .||:.|...:........|.|.|.  ||.:   |..|||.:.::.|||.|
  Rat    67 SGMLVDGFERTFDGKLKCRYCNYASKGTARLIEHIRIHTGEKPHR---CHLCPFASAYERHLEAH 128

  Fly   288 IRKHKNQKPFQCDKCSYTCVNKSMLNSHRKSHSSVYQYRCADCDYATKYCHSFKLHLRKYGHKPG 352
            :|.|..:||::|:.||:.|.::|.|:.||:                           ||  ||  
  Rat   129 MRSHTGEKPYKCELCSFRCSDRSNLSHHRR---------------------------RK--HK-- 162

  Fly   353 MVLDEDGTPNPSLVIDVYGTRRGPKSKN-GGPIASGGSGSG-SRKSNVAAVAPQQQQSQPAQPVA 415
                         ::.:.|||....||. .|.:....|..| ||::.:....|.....:|     
  Rat   163 -------------MVPIKGTRSSLSSKKMWGVLQKKTSNLGYSRRALINLSPPSMVVQKP----- 209

  Fly   416 TSQLSAALQGFPLVQGNSAPPAA--SPVLPLPASPAKSVASVEQTPSLPSPANLLPPLASLLQQN 478
             ..|:......|.:|.:|....|  :|...||..|        |...:.:|.|            
  Rat   210 -DYLNDFTHEIPNIQTDSYETMAKTTPTGGLPRDP--------QELMVDNPLN------------ 253

  Fly   479 RNMAFFPYWNLNLQMLAAQQQAAVLAQLSPRMREQLQQQNQQQSDNEEEEQDDEYERKSVDSAMD 543
                       .|..||.|     |:.|.|      :.||....|              ||..  
  Rat   254 -----------QLSTLAGQ-----LSSLPP------ENQNPASPD--------------VDPC-- 280

  Fly   544 LSQGTPVKEDEQQQQPQQPLAMNLKVEEEATPLMSSSNASRRKGRVLKLDTLLQLRSEAMTSPEQ 608
                    .||:....|||         .|..::|:.:||..             :|.:.|||: 
  Rat   281 --------PDEKPFMIQQP---------SAQAVVSAVSASIP-------------QSSSPTSPD- 314

  Fly   609 LKVPSTPMPTAS----SPIAGRKPMPEEHCSGTSSADESMETAHVPQANTSASSTASSSGNSSNA 669
                  |.|:.|    ||:||                        |.:..||.::..|.||    
  Rat   315 ------PRPSHSQRNYSPVAG------------------------PSSEPSAHTSTPSIGN---- 345

  Fly   670 SSNSNGNSSSNSSSNGTTSAVAAPPSGTPAAAGAIYECKYCDIFFKDAVLYTIHMGYHSCDDVFK 734
                     |..|:...|..|..|.        .::.|::||::|.|.:|||||||.|..::.|:
  Rat   346 ---------SQPSTPAPTLPVQDPQ--------LLHHCQHCDMYFADNILYTIHMGCHGYENPFQ 393

  Fly   735 CNMCGEKCDGPVGLFVHMARNAHS 758
            ||:||.||........|.||..|:
  Rat   394 CNICGCKCKNKYDFACHFARGQHN 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hbNP_731267.1 C2H2 Zn finger 242..262 CDD:275368 4/19 (21%)
C2H2 Zn finger 271..291 CDD:275368 9/19 (47%)
zf-H2C2_2 283..308 CDD:290200 12/24 (50%)
C2H2 Zn finger 299..319 CDD:275368 8/19 (42%)
C2H2 Zn finger 327..345 CDD:275368 0/17 (0%)
C2H2 Zn finger 707..727 CDD:275371 12/19 (63%)
C2H2 Zn finger 735..757 CDD:275371 9/21 (43%)
Ikzf5NP_001101025.1 C2H2 Zn finger 84..104 CDD:275368 4/19 (21%)
zf-H2C2_2 96..121 CDD:404364 9/27 (33%)
C2H2 Zn finger 112..132 CDD:275368 9/19 (47%)
zf-H2C2_2 124..148 CDD:404364 11/23 (48%)
C2H2 Zn finger 140..158 CDD:275368 7/17 (41%)
PHA03269 251..>361 CDD:165527 44/233 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 144 1.000 Inparanoid score I4346
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264318at33208
OrthoFinder 1 1.000 - - FOG0003075
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.060

Return to query results.
Submit another query.