DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hb and Ovol2

DIOPT Version :9

Sequence 1:NP_731267.1 Gene:hb / 41032 FlyBaseID:FBgn0001180 Length:758 Species:Drosophila melanogaster
Sequence 2:XP_038960525.1 Gene:Ovol2 / 296201 RGDID:1306130 Length:274 Species:Rattus norvegicus


Alignment Length:182 Identity:42/182 - (23%)
Similarity:65/182 - (35%) Gaps:29/182 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   190 AKSSQSNIEPEKEHDQMSNSSEDMKYMAESEDDDTNIRMPIYNSHGKMKN--------YKCKTCG 246
            |:||.|...||.|..::.::.....::|.       ::.|:..|..|...        :.|..||
  Rat    67 AESSSSPRAPEPETPELHDAEGTDGHLAA-------MQRPVARSKIKFTTGTCNDSVIHNCDLCG 124

  Fly   247 VVAITKVDFWAHTRTHMKPDKILQCPKCPFVTEFKHHLEYHIRKHKNQKPFQCDKCSYTCVNKSM 311
            .....:.....|.:.|.:..:.| |..|.........|:.|:|.|...:|::|:.|......:..
  Rat   125 KSFRLQRMLNRHLKCHNQVKRHL-CTFCGKGFNDTFDLKRHVRTHTGIRPYKCEVCYKAFTQRCS 188

  Fly   312 LNSHRKSHSSVYQ-----------YRCADCDYATKYCHSFKLHLRKYGHKPG 352
            |.||.|....|.|           |.|.||.|.........||:.. .| ||
  Rat   189 LESHLKKIHGVQQQYAYKQRRDKLYVCEDCGYTGPTQEDLYLHVNS-AH-PG 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hbNP_731267.1 C2H2 Zn finger 242..262 CDD:275368 4/19 (21%)
C2H2 Zn finger 271..291 CDD:275368 5/19 (26%)
zf-H2C2_2 283..308 CDD:290200 7/24 (29%)
C2H2 Zn finger 299..319 CDD:275368 6/19 (32%)
C2H2 Zn finger 327..345 CDD:275368 6/17 (35%)
C2H2 Zn finger 707..727 CDD:275371
C2H2 Zn finger 735..757 CDD:275371
Ovol2XP_038960525.1 COG5048 118..>169 CDD:227381 11/51 (22%)
C2H2 Zn finger 120..140 CDD:275368 4/19 (21%)
C2H2 Zn finger 148..168 CDD:275368 5/19 (26%)
zf-H2C2_2 160..185 CDD:404364 7/24 (29%)
zf-C2H2_3rep 176..>237 CDD:408638 16/62 (26%)
C2H2 Zn finger 176..197 CDD:275368 6/20 (30%)
C2H2 Zn finger 215..232 CDD:275368 5/16 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350862
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.