DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hb and Zfp444

DIOPT Version :9

Sequence 1:NP_731267.1 Gene:hb / 41032 FlyBaseID:FBgn0001180 Length:758 Species:Drosophila melanogaster
Sequence 2:NP_001162614.1 Gene:Zfp444 / 292569 RGDID:1304847 Length:333 Species:Rattus norvegicus


Alignment Length:242 Identity:56/242 - (23%)
Similarity:79/242 - (32%) Gaps:41/242 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 SSEKLQALTPPMDVTP-PKSPAKSSQSNIEP-------EKEHDQMSNSSEDMKYMAESEDDDTNI 226
            |.::..|:.||.|:|. |.......:|.:.|       |.|.....||:....|..|........
  Rat   109 SPDRSTAMRPPRDMTEGPGGSVGKEESGVIPLGTGASSETEVPSTGNSAAMRPYKQEPGSPPPAP 173

  Fly   227 RMPIYNSH-GKMKNYKCKTCGVVAITKVDFWAHTRTHMKPDKILQCPKCPFVTEFKHHLEYHIRK 290
            ..|:..:. .......|..||...:.......|.::| ..:|...||:|......|.||..|...
  Rat   174 LAPVLPAFLAAPGTVSCPECGKSPLKPAHLLRHRQSH-SGEKPHACPECGKAFRRKEHLRRHRGT 237

  Fly   291 H------------KNQKPFQCDKCSYTCVNKSMLNSHRKSHSSVYQYRCADCDYATKYCHSFKLH 343
            |            ..:||..|.:|..|...:..|..|||:||....:.|.:|............|
  Rat   238 HPGSPGPALRPLPAREKPHACCECGKTFYWREHLVRHRKTHSGARPFACWECGKGFGRREHVLRH 302

  Fly   344 LRKYGHKPGMVLDEDGTPNPSLVIDVYGTRRGPKSKNGG---PIASG 387
            .|.:|....:.   .||..|           ||  :.||   |.|.|
  Rat   303 QRIHGRAAAVA---QGTSAP-----------GP--EGGGAFPPWALG 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hbNP_731267.1 C2H2 Zn finger 242..262 CDD:275368 4/19 (21%)
C2H2 Zn finger 271..291 CDD:275368 7/19 (37%)
zf-H2C2_2 283..308 CDD:290200 9/36 (25%)
C2H2 Zn finger 299..319 CDD:275368 7/19 (37%)
C2H2 Zn finger 327..345 CDD:275368 3/17 (18%)
C2H2 Zn finger 707..727 CDD:275371
C2H2 Zn finger 735..757 CDD:275371
Zfp444NP_001162614.1 SCAN 26..103 CDD:280241
COG5048 <188..>286 CDD:227381 25/98 (26%)
C2H2 Zn finger 190..210 CDD:275368 4/19 (21%)
zf-H2C2_2 202..227 CDD:290200 6/25 (24%)
C2H2 Zn finger 218..238 CDD:275368 7/19 (37%)
C2H2 Zn finger 258..278 CDD:275368 7/19 (37%)
zf-H2C2_2 270..295 CDD:290200 8/24 (33%)
C2H2 Zn finger 286..306 CDD:275368 4/19 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350845
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.