DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hb and RGD1564807

DIOPT Version :9

Sequence 1:NP_731267.1 Gene:hb / 41032 FlyBaseID:FBgn0001180 Length:758 Species:Drosophila melanogaster
Sequence 2:XP_008769640.1 Gene:RGD1564807 / 290911 RGDID:1564807 Length:397 Species:Rattus norvegicus


Alignment Length:528 Identity:117/528 - (22%)
Similarity:173/528 - (32%) Gaps:197/528 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   235 GKMKNYKCKTCGVVAITKVDFWAHTRTHM--KPDKILQCPKCPFVTEFKHHLEYHIRKHKNQKPF 297
            ||:   :|..||..:........|||.|.  ||.:   |..|||.:.::.:||.|:|.|..:||:
  Rat    63 GKL---QCSYCGYSSQRTARLMEHTRIHTGEKPHR---CRLCPFASAYERYLEAHMRSHTGEKPY 121

  Fly   298 QCDKCSYTCVNKSMLNSHRKSHSSVYQYRCADCDYATKYCHSFKLHLRKYGHKPGMVLDEDGTPN 362
            :|:.|:|.|...|.|:.||:                           ||:.              
  Rat   122 KCELCAYRCNYGSNLSHHRR---------------------------RKHN-------------- 145

  Fly   363 PSLVIDVYGTRRGPKS-KNGGPIASGGSGSGSRKSNVAAVAPQQQQSQPAQPVATSQLSAALQGF 426
               ::.:.|.|....| |..|.:.|..:....::..:.|:.|.....:|      ..||.:....
  Rat   146 ---LLPLTGPRASLSSVKMWGTLQSKSNVEDGKQGVLIALTPPSVVQKP------DHLSDSTHTI 201

  Fly   427 PLVQ-GNSAPPAASPVLPLPASPAKSVASVEQTPSLPSPANLLPPLASLLQQNRNMAFFPYWNLN 490
            |.|| |.......:.|..||..| :.:..|:      .|.|.|..||.            :|:  
  Rat   202 PNVQNGFCDSTDQTSVCRLPRDP-QGLLFVD------DPLNQLSDLAG------------HWS-- 245

  Fly   491 LQMLAAQQQAAVLAQLSPRMREQLQQQNQQQSDNEEEEQDDEYERKSVDSAMDLSQGTPVKEDEQ 555
              .|..:.|.::.|.:...:.|......||.|                      :||:       
  Rat   246 --TLPPENQNSISADVDSILEEWKPFVMQQPS----------------------AQGS------- 279

  Fly   556 QQQPQQPLAMNLKVEEEATPLMSSSNASRRKGRVLKLDTLLQLRSEAMTSPEQLKVPSTPMPTAS 620
              .||..|.:     ...:|..|||:.|:|.                                 .
  Rat   280 --VPQSSLIL-----FRLSPPSSSSSLSQRD---------------------------------C 304

  Fly   621 SPIAGRKPMPEEHCSGTSSADESMETAHVPQANTSASSTASSSGNSSNASSNSNGNSSSNSSSNG 685
            ||:||....|                                   |...|:...||  |..||..
  Rat   305 SPLAGPSRQP-----------------------------------SGYPSTPILGN--SQPSSPA 332

  Fly   686 TTSAVAAPPSGTPAAAGAIYECKYCDIFFKDAVLYTIHMGYHSCDDVFKCNMCGEKCDGPVGLFV 750
            .|..|..|.        .:|.|::||.:|.|.||||||||.|..|:.|:||:||..|:.......
  Rat   333 PTLKVQGPQ--------LLYFCQHCDTYFADNVLYTIHMGCHGYDNPFQCNICGFNCENKYDFAC 389

  Fly   751 HMARNAHS 758
            |.||..|:
  Rat   390 HFARGQHN 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hbNP_731267.1 C2H2 Zn finger 242..262 CDD:275368 6/19 (32%)
C2H2 Zn finger 271..291 CDD:275368 8/19 (42%)
zf-H2C2_2 283..308 CDD:290200 11/24 (46%)
C2H2 Zn finger 299..319 CDD:275368 8/19 (42%)
C2H2 Zn finger 327..345 CDD:275368 0/17 (0%)
C2H2 Zn finger 707..727 CDD:275371 13/19 (68%)
C2H2 Zn finger 735..757 CDD:275371 8/21 (38%)
RGD1564807XP_008769640.1 C2H2 Zn finger 67..87 CDD:275368 6/19 (32%)
zf-H2C2_2 80..104 CDD:290200 10/26 (38%)
C2H2 Zn finger 95..115 CDD:275368 8/19 (42%)
zf-H2C2_2 107..132 CDD:290200 11/24 (46%)
C2H2 Zn finger 123..141 CDD:275368 7/17 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 144 1.000 Inparanoid score I4346
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264318at33208
OrthoFinder 1 1.000 - - FOG0003075
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.060

Return to query results.
Submit another query.