DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment hb and sfc2

DIOPT Version :9

Sequence 1:	NP_731267.1	Gene:	hb / 41032	FlyBaseID:	FBgn0001180	Length:	758	Species:	Drosophila melanogaster
Sequence 2:	NP_594670.1	Gene:	sfc2 / 2542887	PomBaseID:	SPAC144.09c	Length:	374	Species:	Schizosaccharomyces pombe

Alignment Length:	89	Identity:	28/89 - (31%)
Similarity:	41/89 - (46%)	Gaps:	14/89 - (15%)

- Green bases have known domain annotations that are detailed below.

  Fly   267 KILQCP--KCPFVTEFKHHLEYHIRKHKNQKPFQCD--KCSYTCVNKSMLNSHRKSHSSVYQYRC 327
            ||..||  :|.........||.|:|.|.|::||.||  .||.....||.|..|::.|::|..:.|
pombe    21 KIFHCPYEECGKKYSRPSLLEQHLRTHSNERPFVCDYTGCSKAFYRKSHLKIHKRCHTNVKPFSC 85

  Fly   328 ----ADCDYATKYCHSFKLHLRKY 347
                .|..:.|:.      ||.::
pombe    86 HYDGCDAQFYTQQ------HLERH 103

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
hb	NP_731267.1	C2H2 Zn finger	242..262	CDD:275368
		C2H2 Zn finger	271..291	CDD:275368	7/21 (33%)
		zf-H2C2_2	283..308	CDD:290200	12/26 (46%)
		C2H2 Zn finger	299..319	CDD:275368	8/21 (38%)
		C2H2 Zn finger	327..345	CDD:275368	4/21 (19%)
		C2H2 Zn finger	707..727	CDD:275371
		C2H2 Zn finger	735..757	CDD:275371
sfc2	NP_594670.1	COG5048	1..374	CDD:227381	28/89 (31%)
		C2H2 Zn finger	28..47	CDD:275368	5/18 (28%)
		C2H2 Zn finger	55..77	CDD:275368	8/21 (38%)
		C2H2 Zn finger	85..107	CDD:275368	5/25 (20%)
		C2H2 Zn finger	115..138	CDD:275368
		C2H2 Zn finger	146..165	CDD:275368
		C2H2 Zn finger	206..226	CDD:275368
		C2H2 Zn finger	238..261	CDD:275368
		C2H2 Zn finger	269..286	CDD:275368
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	O	PTHR24393
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	1.100