DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hb and prz1

DIOPT Version :9

Sequence 1:NP_731267.1 Gene:hb / 41032 FlyBaseID:FBgn0001180 Length:758 Species:Drosophila melanogaster
Sequence 2:NP_593073.1 Gene:prz1 / 2541806 PomBaseID:SPAC4G8.13c Length:681 Species:Schizosaccharomyces pombe


Alignment Length:300 Identity:58/300 - (19%)
Similarity:105/300 - (35%) Gaps:82/300 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 SQNDQNSLQHYDANLQQQLLQQQQYQQHFQAAQQQHHHHHHLMGGFNPLTPPGLPNPMQHFYGGN 146
            |.|...|..|.||:|...:                          |:|::|..|.|.:.::...|
pombe   367 SVNSPFSEDHADASLTTHV--------------------------FDPISPTALSNSVLNYDSNN 405

  Fly   147 LRPSPQ----PTPTSASTIAP-----------VAVATGSSEKLQALTPPMD-----------VTP 185
            ...:||    |:..|.|...|           :::....|....:..|.|:           ..|
pombe   406 FSGTPQINVVPSSPSKSQSGPSLPANPLLQTDISITYSQSASPVSGQPAMNENSYDLQNANLCAP 470

  Fly   186 PKSPAKSS--QSN--------IEPEKE-HDQMSNSSEDMKYMAESEDDDTNIRMPIYNSHGKMKN 239
            ..||..::  :||        .||..: :...|:|||.:     |.:.||.:...|.|.:.|..:
pombe   471 EMSPTYTARHRSNSAGSRFDAYEPIPQLYTHFSHSSECL-----SVNQDTELLGKIENDNSKSND 530

  Fly   240 Y--------KCKTCGVVAITKVDFWAHTRTHMKPDKILQCPKCPFVTEFK-----HHLEYHIRKH 291
            |        :.::...:...|.:..:.::...: .|......|.|....|     ::|:.|:..|
pombe   531 YLSVRNTRPRSRSLNSLVGNKSENSSSSKAKSE-SKSQGNYVCTFAGCNKRFTRAYNLKSHMNTH 594

  Fly   292 KNQKPFQCDKCSYTCVNKSMLNSHRKSHSSVYQYRCADCD 331
            .|.:||||..|..:...:.....|.:.|:.:..:.|..|:
pombe   595 TNYRPFQCSICKKSFARQHDKRRHEQLHTGIKAFACVTCN 634

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hbNP_731267.1 C2H2 Zn finger 242..262 CDD:275368 1/19 (5%)
C2H2 Zn finger 271..291 CDD:275368 5/24 (21%)
zf-H2C2_2 283..308 CDD:290200 9/24 (38%)
C2H2 Zn finger 299..319 CDD:275368 3/19 (16%)
C2H2 Zn finger 327..345 CDD:275368 2/4 (50%)
C2H2 Zn finger 707..727 CDD:275371
C2H2 Zn finger 735..757 CDD:275371
prz1NP_593073.1 COG5048 121..620 CDD:227381 55/284 (19%)
zf-C2H2 570..594 CDD:278523 5/23 (22%)
C2H2 Zn finger 577..594 CDD:275368 3/16 (19%)
zf-H2C2_2 586..611 CDD:290200 9/24 (38%)
C2H2 Zn finger 602..622 CDD:275368 3/19 (16%)
zf-H2C2_2 616..639 CDD:290200 4/18 (22%)
C2H2 Zn finger 630..648 CDD:275368 2/4 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24393
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.