DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hb and Plagl1

DIOPT Version :9

Sequence 1:NP_731267.1 Gene:hb / 41032 FlyBaseID:FBgn0001180 Length:758 Species:Drosophila melanogaster
Sequence 2:NP_033564.2 Gene:Plagl1 / 22634 MGIID:1100874 Length:704 Species:Mus musculus


Alignment Length:548 Identity:116/548 - (21%)
Similarity:174/548 - (31%) Gaps:179/548 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   227 RMPIYN-SHGKMKNYKCK--TCGVVAITKVDFWAHTRTHMKPDKILQCPKCPFVTEFKHHLEYHI 288
            :..|:| ||.:.:.:||.  .||...::|.....|..|| .|.||.||..|......|.||:.|:
Mouse    18 KFTIHNYSHSRERPFKCSKAECGKAFVSKYKLMRHMATH-SPQKIHQCTHCEKTFNRKDHLKNHL 81

  Fly   289 RKH-KNQKPFQCDKC----------------------SYTC-------VNKSMLNSHRKSHSS-- 321
            :.| .|:..:.||.|                      ..||       .:..:|..|.|||:.  
Mouse    82 QTHDPNKISYACDDCGKKYHTMLGYKRHLALHSASNGDLTCGVCTLELGSTEVLLDHLKSHAEEK 146

  Fly   322 ------VYQYRCADCD---YATK----------YCHSF--KLHLRKYGHKPGMVLDEDGTPNPSL 365
                  ..:|:|..||   |..|          .|..|  :...:::|.|..:.           
Mouse   147 ANQAPREKKYQCDHCDRCFYTRKDVRRHLVVHTGCKDFLCQFCAQRFGRKDHLT----------- 200

  Fly   366 VIDVYGTRRGPKSKNGGPIASGGSGSGSRKSNVAAVAPQQQQSQPAQPVATSQLSAA-------- 422
                    |..|..:...:......:|..:||...:||.........|:...||.||        
Mouse   201 --------RHTKKTHSQELMQENMQAGDYQSNFQLIAPSTSFQIKVDPMPPFQLGAAPENGLDGG 257

  Fly   423 ----LQGFPLVQGNSAPPAASPVLPL----PASPAKSVASVEQ----------TPSLP-SPANLL 468
                :.|..|.....||....|:.||    |..|.:.:.|:|.          .|..| .|...|
Mouse   258 LPPEVHGLVLAAPEEAPQPMPPLEPLEPLEPLEPLEPMQSLEPLQPLEPMQPLEPMQPLEPMQPL 322

  Fly   469 PPLASL-----------LQQNRNMAFFPYWNLNLQMLAAQQQAAVLAQLSPRMREQLQQQNQQQS 522
            .||..|           |:..:.|       |.:|.:...|....:..:.|.:..|..|..|...
Mouse   323 EPLEPLEPMQPLEPMQPLEPMQPM-------LPMQPMQPMQPMQPMLPMQPMLPMQPMQPMQPML 380

  Fly   523 DNEEEE-----------------QDDEYERKSVDSAMDLSQGTPVKEDEQQ------------QQ 558
            ...|..                 |:.:|  ..|.::.....|.|||.|.:.            |:
Mouse   381 PMPEPSFTLHPGVVPTSPPPIILQEHKY--NPVPTSYAPFVGMPVKADGKAFCNVGFFEEFPLQE 443

  Fly   559 PQQPLAMNL----------KVEEEATPLMSSSN----ASRRKGRVLKLDTLLQLRSEAMTSPEQL 609
            ||.||..|.          ||......|:.:.|    ||      |::.:||........:|:..
Mouse   444 PQAPLKFNPCFEMPMEGFGKVTLSKELLVDAVNIAIPAS------LEISSLLGFWQLPPPTPQNG 502

  Fly   610 KVPST-------PMPTASSPIAGRKPMP 630
            .|.||       |:|...:.:|.::|.|
Mouse   503 FVNSTIPVGPGEPLPHRITCLAQQQPPP 530

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hbNP_731267.1 C2H2 Zn finger 242..262 CDD:275368 5/21 (24%)
C2H2 Zn finger 271..291 CDD:275368 6/19 (32%)
zf-H2C2_2 283..308 CDD:290200 10/54 (19%)
C2H2 Zn finger 299..319 CDD:275368 8/48 (17%)
C2H2 Zn finger 327..345 CDD:275368 7/32 (22%)
C2H2 Zn finger 707..727 CDD:275371
C2H2 Zn finger 735..757 CDD:275371
Plagl1NP_033564.2 C2H2 Zn finger 6..26 CDD:275368 2/7 (29%)
C2H2 Zn finger 34..56 CDD:275368 5/21 (24%)
zf-H2C2_2 49..73 CDD:290200 9/24 (38%)
C2H2 Zn finger 64..84 CDD:275368 6/19 (32%)
C2H2 Zn finger 93..113 CDD:275368 3/19 (16%)
C2H2 Zn finger 122..142 CDD:275368 4/19 (21%)
C2H2 Zn finger 158..178 CDD:275368 5/19 (26%)
C2H2 Zn finger 186..207 CDD:275368 4/39 (10%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167847312
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.