DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hb and Zkscan2

DIOPT Version :9

Sequence 1:NP_731267.1 Gene:hb / 41032 FlyBaseID:FBgn0001180 Length:758 Species:Drosophila melanogaster
Sequence 2:NP_001074798.1 Gene:Zkscan2 / 210162 MGIID:2444060 Length:960 Species:Mus musculus


Alignment Length:123 Identity:42/123 - (34%)
Similarity:60/123 - (48%) Gaps:10/123 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   234 HGKMKNYKCKTCGVVAITKVDFWAHTRTHM--KPDKILQCPKCPFVTEFKH--HLEYHIRKHKNQ 294
            |...|.:||..||.......:|.||.|.|.  ||.:..:|.||     |..  .|..|.|.|..:
Mouse   790 HTGEKPFKCPDCGKSFNDSSNFGAHQRVHTGEKPYRCRECGKC-----FSQSSSLIIHQRTHTGE 849

  Fly   295 KPFQCDKCSYTCVNKSMLNSHRKSHSSVYQYRCADCDYATKYCHSFKLHLRKY-GHKP 351
            ||:||::|..:..|.|..::||:.|:....|:|.||:.:...|..|:.|.|.: |.||
Mouse   850 KPYQCEECGKSFTNSSHFSAHRRIHTEENPYKCGDCEKSFNNCARFREHQRIHNGEKP 907

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hbNP_731267.1 C2H2 Zn finger 242..262 CDD:275368 7/19 (37%)
C2H2 Zn finger 271..291 CDD:275368 7/21 (33%)
zf-H2C2_2 283..308 CDD:290200 9/24 (38%)
C2H2 Zn finger 299..319 CDD:275368 6/19 (32%)
C2H2 Zn finger 327..345 CDD:275368 6/17 (35%)
C2H2 Zn finger 707..727 CDD:275371
C2H2 Zn finger 735..757 CDD:275371
Zkscan2NP_001074798.1 SCAN 42..148 CDD:128708
SCAN 42..129 CDD:280241
KRAB <241..282 CDD:214630
Myb_DNA-bind_4 334..415 CDD:290549
ABC_trans_N <466..505 CDD:291196
Myb_DNA-bind_4 490..571 CDD:290549
COG5048 <766..915 CDD:227381 42/123 (34%)
zf-C2H2 768..790 CDD:278523 42/123 (34%)
C2H2 Zn finger 770..790 CDD:275368 42/123 (34%)
zf-H2C2_2 782..806 CDD:290200 6/15 (40%)
C2H2 Zn finger 798..818 CDD:275368 7/19 (37%)
zf-H2C2_2 814..835 CDD:290200 9/25 (36%)
C2H2 Zn finger 826..846 CDD:275368 7/24 (29%)
zf-H2C2_2 838..863 CDD:290200 9/24 (38%)
C2H2 Zn finger 854..874 CDD:275368 6/19 (32%)
zf-H2C2_2 866..891 CDD:290200 7/24 (29%)
C2H2 Zn finger 882..902 CDD:275368 7/19 (37%)
zf-H2C2_2 895..918 CDD:290200 6/13 (46%)
C2H2 Zn finger 910..930 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167847299
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.