DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hb and sdz-12

DIOPT Version :9

Sequence 1:NP_731267.1 Gene:hb / 41032 FlyBaseID:FBgn0001180 Length:758 Species:Drosophila melanogaster
Sequence 2:NP_494634.1 Gene:sdz-12 / 184388 WormBaseID:WBGene00017406 Length:330 Species:Caenorhabditis elegans


Alignment Length:528 Identity:88/528 - (16%)
Similarity:133/528 - (25%) Gaps:266/528 - (50%)


- Green bases have known domain annotations that are detailed below.


  Fly   267 KILQCPKCPFVTEFKHHLEYHIRKHKNQKP---------FQCDKCSYTCVNKSMLNSHRKSHSSV 322
            |:.||..|......:..|..|: ||...:|         |:|:.|.....||..|..|:.:||..
 Worm    25 KVPQCQVCKRKFANQKTLRTHM-KHITCRPGRSNVVNHKFRCENCEKQFTNKPNLKRHQITHSGS 88

  Fly   323 YQYRCADC-------DYATKYCHSFKLHLRKYGHKPGMVLDEDGTPNPSLVIDVYGTRRGPKS-- 378
            ...:|:.|       |...::.|:   ||::..|....||      |.|:....|   .|.::  
 Worm    89 KSKKCSTCQRTFFREDQLQRHLHN---HLKERSHFDCPVL------NCSMQFVFY---EGVENHL 141

  Fly   379 --------KNGGPIASGGSGSGS-----------RKSNVAAVAPQQQQSQPAQPVATSQLSAALQ 424
                    ....|........||           .|..:.:.||        .|.::::||    
 Worm   142 VNHHHFSYSESAPCGKCHKLFGSPRHLLVHYHFDHKEALRSSAP--------APTSSARLS---- 194

  Fly   425 GFPLVQGNSAPPAASPVLPLPASPAKSVASVEQTPSLPSPANLLPPLASLLQQNRNMAFFPYWNL 489
              |:....|..|.|.    |..||                                         
 Worm   195 --PITVSTSGSPRAQ----LAISP----------------------------------------- 212

  Fly   490 NLQMLAAQQQAAVLAQLSPRMREQLQQQNQQQSDNEEEEQDDEYERKSVDSAMDLSQGTPVKEDE 554
                                                                             
 Worm   213 ----------------------------------------------------------------- 212

  Fly   555 QQQQPQQPLAMNLKVEEEATPLMSSSNASRRKGRVLKLDTLLQLRSEAMTSPEQLKVPSTPMPTA 619
             |::|.|.|::||                                                    
 Worm   213 -QEKPPQKLSINL---------------------------------------------------- 224

  Fly   620 SSPIAGRKPMPEEHCSGTSSADESMETAHVPQANTSASSTASSSGNSSNASSNSNGNSSSNSSSN 684
                 |..||.||.|...|        |.:|..:...|.|.     |.|.....|          
 Worm   225 -----GTSPMIEEFCEQNS--------ATLPNTDQQLSPTL-----SPNEPRFRN---------- 261

  Fly   685 GTTSAVAAPPSGTPAAAGAIYECKYCDIFFKDAVLYTIHMGYHSCDDVFKCNMCGEKCDGPVGLF 749
                .:.:.|  ||:     :|||:|.|.|.||.:..:|...|:....|||.:||.:|...:...
 Worm   262 ----LITSEP--TPS-----FECKHCTIKFHDATMSIMHNALHAPGSPFKCAICGAECGNKIVFT 315

  Fly   750 VHMARNAH 757
            :|:...:|
 Worm   316 MHIITASH 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hbNP_731267.1 C2H2 Zn finger 242..262 CDD:275368
C2H2 Zn finger 271..291 CDD:275368 4/19 (21%)
zf-H2C2_2 283..308 CDD:290200 8/33 (24%)
C2H2 Zn finger 299..319 CDD:275368 6/19 (32%)
C2H2 Zn finger 327..345 CDD:275368 5/24 (21%)
C2H2 Zn finger 707..727 CDD:275371 8/19 (42%)
C2H2 Zn finger 735..757 CDD:275371 5/21 (24%)
sdz-12NP_494634.1 SFP1 <25..86 CDD:227516 16/61 (26%)
C2H2 Zn finger 29..48 CDD:275368 4/19 (21%)
COG5236 <32..>197 CDD:227561 38/191 (20%)
C2H2 Zn finger 65..85 CDD:275368 6/19 (32%)
C2H2 Zn finger 93..113 CDD:275368 4/22 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264318at33208
OrthoFinder 1 1.000 - - FOG0003075
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.