DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment hb and Zfp369

DIOPT Version :9

Sequence 1:	NP_731267.1	Gene:	hb / 41032	FlyBaseID:	FBgn0001180	Length:	758	Species:	Drosophila melanogaster
Sequence 2:	NP_848141.3	Gene:	Zfp369 / 170936	MGIID:	2176229	Length:	845	Species:	Mus musculus

Alignment Length:	114	Identity:	31/114 - (27%)
Similarity:	52/114 - (45%)	Gaps:	6/114 - (5%)

- Green bases have known domain annotations that are detailed below.

  Fly   241 KCKTCGVVAITKVDFWAHTRTHM--KPDKILQCPKCPFVTEFKHHLEYHIRKHKNQKPFQCDKCS 303
            :|..||.:......|..|.:.|.  :|...:.|.|. ||.  ...|..|:|.|..::||:|.:|.
Mouse   702 QCSECGKMFRNARYFSVHKKIHTGERPYMCMSCGKA-FVQ--SSSLTQHLRIHSGERPFECSECG 763

  Fly   304 YTCVNKSMLNSHRKSHSSVYQYRCADCDYATKYCHSFKLHLRKY-GHKP 351
            .|..::|..:.|.::|:....|:|..|..|.:.......|:|.: |.:|
Mouse   764 RTFSDRSAASQHLRTHTGAKPYQCQHCGKAFRQSSHLTRHVRIHTGERP 812

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
hb	NP_731267.1	C2H2 Zn finger	242..262	CDD:275368	5/19 (26%)
		C2H2 Zn finger	271..291	CDD:275368	7/19 (37%)
		zf-H2C2_2	283..308	CDD:290200	9/24 (38%)
		C2H2 Zn finger	299..319	CDD:275368	5/19 (26%)
		C2H2 Zn finger	327..345	CDD:275368	4/17 (24%)
		C2H2 Zn finger	707..727	CDD:275371
		C2H2 Zn finger	735..757	CDD:275371
Zfp369	NP_848141.3	KRAB	35..94	CDD:214630
		KRAB	35..74	CDD:279668
		SCAN	179..266	CDD:280241
		KRAB	300..>340	CDD:214630
		KRAB	300..339	CDD:279668
		C2H2 Zn finger	676..695	CDD:275370
		C2H2 Zn finger	703..723	CDD:275368	5/19 (26%)
		zf-H2C2_2	715..740	CDD:290200	7/25 (28%)
		COG5048	727..>792	CDD:227381	20/67 (30%)
		C2H2 Zn finger	731..751	CDD:275368	7/22 (32%)
		zf-H2C2_2	743..767	CDD:290200	9/23 (39%)
		zf-C2H2	757..779	CDD:278523	6/21 (29%)
		C2H2 Zn finger	759..779	CDD:275368	5/19 (26%)
		zf-C2H2	785..807	CDD:278523	6/21 (29%)
		C2H2 Zn finger	787..807	CDD:275368	5/19 (26%)
		zf-H2C2_2	799..824	CDD:290200	4/14 (29%)
		C2H2 Zn finger	815..835	CDD:275368
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C167847304
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.930