DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hb and ZNF274

DIOPT Version :9

Sequence 1:NP_731267.1 Gene:hb / 41032 FlyBaseID:FBgn0001180 Length:758 Species:Drosophila melanogaster
Sequence 2:NP_598009.1 Gene:ZNF274 / 10782 HGNCID:13068 Length:653 Species:Homo sapiens


Alignment Length:368 Identity:72/368 - (19%)
Similarity:123/368 - (33%) Gaps:97/368 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 WETTATTNYEQHNAWYNSMFAANIKQEPGHHLDGNSVASSPRQSPIPSTNHLEQFLKQQQQQLQQ 68
            ||||..          |...|.|              :..|.:.|.||.            ::|:
Human   328 WETTLE----------NKELAPN--------------SDIPEEEPAPSL------------KVQE 356

  Fly    69 QPMDTLCAMTPSPSQNDQNSLQHYDANLQQQLLQQQQYQQHFQAAQQQHHHHHHLMGG-----FN 128
            ...|  ||::.:.....|..:|    .:|..:|:|.:..|.....|::|..:......     .|
Human   357 SSRD--CALSSTLEDTLQGGVQ----EVQDTVLKQMESAQEKDLPQKKHFDNRESQANSGALDTN 415

  Fly   129 PLTPPGLPNPMQHFYGGNLRPSPQPTPTSASTIAPVAVATGSSEKLQALTPPMDVTPPKSPAKSS 193
            .::...:.||...                        ..:|:.:..|.|   :...||:...:..
Human   416 QVSLQKIDNPESQ------------------------ANSGALDTNQVL---LHKIPPRKRLRKR 453

  Fly   194 QSNIEPEK------------EHDQMSNSSEDMKYMAESEDDDTNIRMPIYNSHGKMKNYKCKTCG 246
            .|.::..|            |..:....:...|..:.|....|.||:     |...:..:|..||
Human   454 DSQVKSMKHNSRVKIHQKSCERQKAKEGNGCRKTFSRSTKQITFIRI-----HKGSQVCRCSECG 513

  Fly   247 VVAITKVDFWAHTRTHM--KPDKILQCPKCPFVTEFKHHLEYHIRKHKNQKPFQCDKCSYTCVNK 309
            .:......|..|.:.|.  :|.....|.| .||.  ...|..|.|.|..::||:|.:|..|..::
Human   514 KIFRNPRYFSVHKKIHTGERPYVCQDCGK-GFVQ--SSSLTQHQRVHSGERPFECQECGRTFNDR 575

  Fly   310 SMLNSHRKSHSSVYQYRCADCDYATKYCHSFKLHLRKY-GHKP 351
            |.::.|.::|:....|:|.||..|.:.......|.|.: |.:|
Human   576 SAISQHLRTHTGAKPYKCQDCGKAFRQSSHLIRHQRTHTGERP 618

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hbNP_731267.1 C2H2 Zn finger 242..262 CDD:275368 5/19 (26%)
C2H2 Zn finger 271..291 CDD:275368 7/19 (37%)
zf-H2C2_2 283..308 CDD:290200 9/24 (38%)
C2H2 Zn finger 299..319 CDD:275368 5/19 (26%)
C2H2 Zn finger 327..345 CDD:275368 5/17 (29%)
C2H2 Zn finger 707..727 CDD:275371
C2H2 Zn finger 735..757 CDD:275371
ZNF274NP_598009.1 KRAB 14..73 CDD:214630
KRAB 14..53 CDD:279668
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 139..159
SCAN 157..269 CDD:128708
SCAN 157..245 CDD:280241
KRAB 287..>327 CDD:214630
KRAB 287..326 CDD:279668
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 339..359 6/45 (13%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 388..414 3/25 (12%)
COG5048 <389..644 CDD:227381 52/265 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 448..485 3/36 (8%)
C2H2 Zn finger 481..501 CDD:275368 5/24 (21%)
C2H2 Zn finger 509..529 CDD:275368 5/19 (26%)
zf-H2C2_2 521..546 CDD:290200 7/25 (28%)
C2H2 Zn finger 537..557 CDD:275368 7/22 (32%)
zf-H2C2_2 549..573 CDD:290200 9/23 (39%)
zf-C2H2 563..585 CDD:278523 6/21 (29%)
C2H2 Zn finger 565..585 CDD:275368 5/19 (26%)
zf-C2H2 591..613 CDD:278523 7/21 (33%)
C2H2 Zn finger 593..613 CDD:275368 6/19 (32%)
zf-H2C2_2 605..630 CDD:290200 4/14 (29%)
C2H2 Zn finger 621..641 CDD:275368
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 632..653
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156897
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.