DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11755 and Cdpf1

DIOPT Version :9

Sequence 1:NP_001262381.1 Gene:CG11755 / 41031 FlyBaseID:FBgn0037611 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_001158097.1 Gene:Cdpf1 / 72355 MGIID:1919605 Length:119 Species:Mus musculus


Alignment Length:108 Identity:38/108 - (35%)
Similarity:60/108 - (55%) Gaps:7/108 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 FNCSGCEMHEMVHYFGRKPPFALGVIYPEDNYVMRDPFQPPPPRWQSKPEYYIAMGTKCSICSKT 107
            |.|..|.:.....|.|:|||....|:..|::|:|:|||.....|       ::.:|::||:||:.
Mouse    13 FECQLCALSAPYSYVGQKPPDTQAVVLLEESYIMKDPFSSDKAR-------FLVLGSRCSVCSRL 70

  Fly   108 VCKDPGCSFYYTASFCLPCGKEELKNWPPEAQARIRKQMSVSQ 150
            ||..|.||.:|:...||||.:|.:..:|.|.|..:.|:.|.|:
Mouse    71 VCVGPDCSLFYSKRVCLPCVQENMSAFPQEIQQDVEKRKSTSK 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11755NP_001262381.1 C6_DPF 43..143 CDD:287179 35/99 (35%)
Cdpf1NP_001158097.1 C6_DPF 13..106 CDD:370851 35/99 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167849946
Domainoid 1 1.000 83 1.000 Domainoid score I8380
eggNOG 1 0.900 - - E1_KOG4543
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 88 1.000 Inparanoid score I5126
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008913
OrthoInspector 1 1.000 - - oto92698
orthoMCL 1 0.900 - - OOG6_108417
Panther 1 1.100 - - LDO PTHR31849
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3746
SonicParanoid 1 1.000 - - X6656
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.780

Return to query results.
Submit another query.