DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11755 and D2089.8

DIOPT Version :9

Sequence 1:NP_001262381.1 Gene:CG11755 / 41031 FlyBaseID:FBgn0037611 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_001338812.1 Gene:D2089.8 / 32928585 WormBaseID:WBGene00271706 Length:137 Species:Caenorhabditis elegans


Alignment Length:120 Identity:43/120 - (35%)
Similarity:58/120 - (48%) Gaps:19/120 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 EELKKPIDPEEEDERVARIEFNCSGCEMHEMVHYFGRKPPFALGVI---YPEDNYVMRDPFQPPP 84
            ||..:.|||        .|:|.|..|.:.|.. .||.     |.||   |....|.|||||:||.
 Worm    19 EEQPQLIDP--------FIDFECHVCHLKERT-LFGE-----LKVIDGRYDSPVYFMRDPFKPPS 69

  Fly    85 PRWQSKP--EYYIAMGTKCSICSKTVCKDPGCSFYYTASFCLPCGKEELKNWPPE 137
            .....||  ..::.:||.||.|::.||....||.::.|:||.||...|.:.:||:
 Worm    70 RDRAKKPCLNDFLVLGTPCSACNQPVCMSDACSLFFGANFCAPCVSRERRRFPPQ 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11755NP_001262381.1 C6_DPF 43..143 CDD:287179 37/100 (37%)
D2089.8NP_001338812.1 C6_DPF 31..125 CDD:370851 37/100 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160167128
Domainoid 1 1.000 68 1.000 Domainoid score I6385
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 70 1.000 Inparanoid score I3911
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG28936
OrthoDB 1 1.010 - - D1594478at2759
OrthoFinder 1 1.000 - - FOG0008913
OrthoInspector 1 1.000 - - oto19201
orthoMCL 1 0.900 - - OOG6_108417
Panther 1 1.100 - - LDO PTHR31849
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6656
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1312.910

Return to query results.
Submit another query.