DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL19 and MRPL19

DIOPT Version :9

Sequence 1:NP_524284.1 Gene:mRpL19 / 41028 FlyBaseID:FBgn0037608 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_055578.2 Gene:MRPL19 / 9801 HGNCID:14052 Length:292 Species:Homo sapiens


Alignment Length:249 Identity:116/249 - (46%)
Similarity:165/249 - (66%) Gaps:23/249 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 PPTTPTSPVNRKTIIPANYRFVYPEFLP-----DPKVEWRNLVREKLERLDMLDRRKQIDLPEFY 103
            ||..|......:.:.|.. ||:.|||:|     ||       ::.::||.|||:|||.:.:||||
Human    56 PPPKPVIVDKHRPVEPER-RFLSPEFIPRRGRTDP-------LKFQIERKDMLERRKVLHIPEFY 112

  Fly   104 VGSVLAVTSSDPHAAGKTSRFVGICINRDRCGLRARFILRNVIDHQGMEVVYELYDPTILKIEVL 168
            |||:|.||::||:|:||.|:|:||||.|...||.|.|||||||:.||:|:.:|||:|.:.:|:|:
Human   113 VGSILRVTTADPYASGKISQFLGICIQRSGRGLGATFILRNVIEGQGVEICFELYNPRVQEIQVV 177

  Fly   169 RLEKRLDDSLFYLRDALPEYSTFDENMEAEPLEEGAPVPVNDIKVVLRPRPWLERWERQ--NLRG 231
            :|||||||||.|||||||||||||.||:....|....||||::||.::|:||.:||||.  |::|
Human   178 KLEKRLDDSLLYLRDALPEYSTFDVNMKPVVQEPNQKVPVNELKVKMKPKPWSKRWERPNFNIKG 242

  Fly   232 VANIDEYLKDKHRLSAAKVQKPWEKYDMMKDYRSSIPEEEQTEIFAEVHTELHA 285
            : ..|..|.::....|.|..:||.::|||::|.:|       :|.|.:..|:.|
Human   243 I-RFDLCLTEQQMKEAQKWNQPWLEFDMMREYDTS-------KIEAAIWKEIEA 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL19NP_524284.1 Ribosomal_L19 94..183 CDD:294284 54/88 (61%)
MRPL19NP_055578.2 Ribosomal_L19 108..192 CDD:412361 52/83 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157086
Domainoid 1 1.000 119 1.000 Domainoid score I5829
eggNOG 1 0.900 - - E1_COG0335
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H8851
Inparanoid 1 1.050 217 1.000 Inparanoid score I3608
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1387536at2759
OrthoFinder 1 1.000 - - FOG0004273
OrthoInspector 1 1.000 - - oto90490
orthoMCL 1 0.900 - - OOG6_101282
Panther 1 1.100 - - LDO PTHR15680
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2755
SonicParanoid 1 1.000 - - X5327
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.790

Return to query results.
Submit another query.