DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL19 and rplS

DIOPT Version :10

Sequence 1:NP_524284.1 Gene:mRpL19 / 41028 FlyBaseID:FBgn0037608 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_417097.1 Gene:rplS / 947096 ECOCYCID:EG10880 Length:115 Species:Escherichia coli


Alignment Length:118 Identity:30/118 - (25%)
Similarity:56/118 - (47%) Gaps:7/118 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 NLVREKLERLDMLDRRKQIDLPEFYVGSVLAVTSSDPHAAGK-TSRFVGICINRDRCGLRARFIL 142
            |:::: ||:    ::.|| |:|.|..|..:.|.......:.| ...|.|:.|.....||.:.|.:
E. coli     3 NIIKQ-LEQ----EQMKQ-DVPSFRPGDTVEVKVWVVEGSKKRLQAFEGVVIAIRNRGLHSAFTV 61

  Fly   143 RNVIDHQGMEVVYELYDPTILKIEVLRLEKRLDDSLFYLRDALPEYSTFDENM 195
            |.:.:.:|:|.|::.:.|.:..|.|.|........|:|||:...:.:...|.:
E. coli    62 RKISNGEGVERVFQTHSPVVDSISVKRRGAVRKAKLYYLRERTGKAARIKERL 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL19NP_524284.1 Ribosomal_L19 98..183 CDD:460130 23/85 (27%)
rplSNP_417097.1 rplS 2..115 CDD:235418 30/118 (25%)

Return to query results.
Submit another query.