DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL19 and IMG1

DIOPT Version :9

Sequence 1:NP_524284.1 Gene:mRpL19 / 41028 FlyBaseID:FBgn0037608 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_009975.1 Gene:IMG1 / 850413 SGDID:S000000642 Length:169 Species:Saccharomyces cerevisiae


Alignment Length:175 Identity:40/175 - (22%)
Similarity:72/175 - (41%) Gaps:34/175 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 RKTIIPANYRFVYPEFLPDPKVEWRNLVRE-KLERLDMLD----RRKQI---DLPEFYVGSVLAV 110
            |..::||..|...|.:.|..::....:::: .|..::.||    :||.|   :......|.|:.:
Yeast    14 RSYMVPATKRKTIPVYPPVQRIASSQIMKQVALSEIESLDPGAVKRKLISKKNKDRLKAGDVVRI 78

  Fly   111 TSSDPHAAGKTSRFVGICINRDRCGL--RARFILRNVIDHQGMEVVYELYDPTILKIEVL--RLE 171
            .......:..|  |||..::.||..|  .|..:|||.|....:|:...|:.|.|.:|::|  .:.
Yeast    79 VYDSSKCSYDT--FVGYILSIDRKQLVQDASLLLRNQIAKTAVEIRVPLFSPLIERIDLLTPHVS 141

  Fly   172 KRLDDSLFYLRDALPEYSTFDENMEAEPLEEGAPVPVNDIKVVLR 216
            .|..:..:|:|                    |..:.|.|::..||
Yeast   142 SRQRNKHYYIR--------------------GTRLDVGDLEAGLR 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL19NP_524284.1 Ribosomal_L19 94..183 CDD:294284 25/95 (26%)
IMG1NP_009975.1 RplS 30..158 CDD:223412 31/149 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0335
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004273
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101282
Panther 1 1.100 - - LDO PTHR15680
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.900

Return to query results.
Submit another query.