DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL19 and AT1G24240

DIOPT Version :9

Sequence 1:NP_524284.1 Gene:mRpL19 / 41028 FlyBaseID:FBgn0037608 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_564213.1 Gene:AT1G24240 / 839038 AraportID:AT1G24240 Length:222 Species:Arabidopsis thaliana


Alignment Length:116 Identity:31/116 - (26%)
Similarity:55/116 - (47%) Gaps:14/116 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 REKLERLD--------MLDR------RKQIDLPEFYVGSVLAVTSSDPHAAGKTSRFVGICINRD 132
            |.|.:|||        ::|:      |...::||...|.::.:....|....:.|...|:.|.|.
plant    99 RIKFKRLDKTAKHIMQIVDKEAVEEVRTLREIPEIKPGYIVQLKVEVPENKRRVSIVKGVVIARR 163

  Fly   133 RCGLRARFILRNVIDHQGMEVVYELYDPTILKIEVLRLEKRLDDSLFYLRD 183
            ..||.:.|.:|.::...|:|.::.||.|.:..|:|:..:|.....|:|||:
plant   164 NAGLNSTFRIRRLVAGVGVESMFPLYSPNLRVIKVVDKKKVRRAKLYYLRE 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL19NP_524284.1 Ribosomal_L19 94..183 CDD:294284 24/88 (27%)
AT1G24240NP_564213.1 GATase1_like 31..>64 CDD:284498
Ribosomal_L19 119..216 CDD:294284 25/96 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 50 1.000 Domainoid score I4361
eggNOG 1 0.900 - - E1_COG0335
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1387536at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101282
Panther 1 1.100 - - O PTHR15680
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.820

Return to query results.
Submit another query.