DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL19 and AT4G17560

DIOPT Version :10

Sequence 1:NP_524284.1 Gene:mRpL19 / 41028 FlyBaseID:FBgn0037608 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_567531.1 Gene:AT4G17560 / 827471 AraportID:AT4G17560 Length:225 Species:Arabidopsis thaliana


Alignment Length:197 Identity:45/197 - (22%)
Similarity:90/197 - (45%) Gaps:16/197 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 NLSTRVMLNRLTQQCVYKRI-VTFSTKTAEHVIENQEEQKKEAPPTTPTSPV-----NRKTIIPA 60
            ::.:|:.::||:......:. .:..|:.....|...||...||......:.:     |.:.::.|
plant    37 SMDSRISVSRLSLNHPGSKFGFSLDTRVRNEFIVRAEEGNTEAESEEFVAEIADTEGNVEEVVEA 101

  Fly    61 NYRFVYPEFLPDPKV-EWRNLVREKLERLDMLDRRKQIDLPEFYVGSVLAVTSSDPHAAGKTSRF 124
            .     |...|..|: :...::.:|  .:::.::.:.:  ||...|.::.:....|....:.|.:
plant   102 K-----PTRKPRIKLGDVMGILNQK--AIEVAEKVRPV--PEIRTGDIVEIKLEVPENKRRLSIY 157

  Fly   125 VGICINRDRCGLRARFILRNVIDHQGMEVVYELYDPTILKIEVLRLEKRLDDSLFYLRDALPEYS 189
            .||.::|...|:.....:|.:|...|:|:|:.:|.|.|.:|:|:...|.....|:||||.||..|
plant   158 KGIVMSRQNAGIHTTIRIRRIIAGIGVEIVFPIYSPNIKEIKVVSHRKVRRARLYYLRDKLPRLS 222

  Fly   190 TF 191
            ||
plant   223 TF 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL19NP_524284.1 Ribosomal_L19 98..183 CDD:460130 23/84 (27%)
AT4G17560NP_567531.1 Ribosomal_L19 121..217 CDD:460130 25/99 (25%)

Return to query results.
Submit another query.