DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL19 and AT4G11630

DIOPT Version :9

Sequence 1:NP_524284.1 Gene:mRpL19 / 41028 FlyBaseID:FBgn0037608 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_192900.1 Gene:AT4G11630 / 826768 AraportID:AT4G11630 Length:225 Species:Arabidopsis thaliana


Alignment Length:116 Identity:32/116 - (27%)
Similarity:56/116 - (48%) Gaps:14/116 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 REKLERLD--------MLDR------RKQIDLPEFYVGSVLAVTSSDPHAAGKTSRFVGICINRD 132
            |.|.:|||        ::|:      |...::||...|.::.:....|....:.|...|:.|.|.
plant   102 RIKFKRLDKTAKHIMQIVDKEAVEEVRSLREIPEIKPGYIVQLKVEVPENKRRVSIVKGVVIARR 166

  Fly   133 RCGLRARFILRNVIDHQGMEVVYELYDPTILKIEVLRLEKRLDDSLFYLRD 183
            ..||.:.|.:|.::...|:|.::.||.|.:.:|:|:..:|.....|:||||
plant   167 NAGLNSTFRIRRLVAGVGVESMFPLYSPNLREIKVVDKKKVRRAKLYYLRD 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL19NP_524284.1 Ribosomal_L19 94..183 CDD:294284 24/88 (27%)
AT4G11630NP_192900.1 Ribosomal_L19 122..219 CDD:376502 26/96 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 50 1.000 Domainoid score I4361
eggNOG 1 0.900 - - E1_COG0335
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1387536at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101282
Panther 1 1.100 - - LDO PTHR15680
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.820

Return to query results.
Submit another query.