DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL19 and mrpl19

DIOPT Version :9

Sequence 1:NP_524284.1 Gene:mRpL19 / 41028 FlyBaseID:FBgn0037608 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_001003544.1 Gene:mrpl19 / 445150 ZFINID:ZDB-GENE-040801-55 Length:281 Species:Danio rerio


Alignment Length:262 Identity:124/262 - (47%)
Similarity:167/262 - (63%) Gaps:14/262 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 STKTAEHVIENQEEQKKEAPPTTPTSPVNRKTIIPANYRFVY-PEFLPDPKVEWRNLVREKLERL 88
            ||....|.   .:...|..|||.|.  ...|:...|:.|.|. |||:| |: :..:.::..:||.
Zfish    29 STSVMRHA---SDGPSKFIPPTKPV--FTDKSQEEASVRRVLSPEFIP-PR-QRTDQIKFYIERK 86

  Fly    89 DMLDRRKQIDLPEFYVGSVLAVTSSDPHAAGKTSRFVGICINRDRCGLRARFILRNVIDHQGMEV 153
            ||:.|||.:.:|||||||:||||.:||:|:|..:||||||..|...||.|.||||||||.||:|:
Zfish    87 DMIQRRKVLQIPEFYVGSILAVTMTDPYASGNLNRFVGICTQRSGKGLGATFILRNVIDGQGVEI 151

  Fly   154 VYELYDPTILKIEVLRLEKRLDDSLFYLRDALPEYSTFDENMEAEPLEEGAPVPVNDIKVVLRPR 218
            .||||.|.:.|||||:|||||||:|.|||||||||||||.:|:....|....:|||.:||.::|:
Zfish   152 CYELYSPRMRKIEVLKLEKRLDDNLMYLRDALPEYSTFDFDMQPVHYELTKDIPVNPLKVKMKPK 216

  Fly   219 PWLERWERQ--NLRGVANIDEYLKDKHRLSAAKVQKPWEKYDMMKDYRSSIPEEEQTEIFAEVHT 281
            ||.:||||.  :::|: ..|.||..:....|.|..:||.:|||:|:|.:|..|:   :|..||..
Zfish   217 PWSKRWERPKFDIKGI-RFDLYLTPEQMEHAQKWGEPWREYDMLKEYDTSSLEK---KILEEVDE 277

  Fly   282 EL 283
            .|
Zfish   278 NL 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL19NP_524284.1 Ribosomal_L19 94..183 CDD:294284 58/88 (66%)
mrpl19NP_001003544.1 Ribosomal_L19 82..181 CDD:294284 63/98 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592780
Domainoid 1 1.000 123 1.000 Domainoid score I5567
eggNOG 1 0.900 - - E1_COG0335
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H8851
Inparanoid 1 1.050 214 1.000 Inparanoid score I3611
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1387536at2759
OrthoFinder 1 1.000 - - FOG0004273
OrthoInspector 1 1.000 - - oto38971
orthoMCL 1 0.900 - - OOG6_101282
Panther 1 1.100 - - LDO PTHR15680
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2755
SonicParanoid 1 1.000 - - X5327
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1413.830

Return to query results.
Submit another query.