DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL19 and mrpl19

DIOPT Version :9

Sequence 1:NP_524284.1 Gene:mRpL19 / 41028 FlyBaseID:FBgn0037608 Length:306 Species:Drosophila melanogaster
Sequence 2:XP_002936026.4 Gene:mrpl19 / 100496116 XenbaseID:XB-GENE-1003776 Length:305 Species:Xenopus tropicalis


Alignment Length:289 Identity:129/289 - (44%)
Similarity:191/289 - (66%) Gaps:25/289 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNLSTRVMLNRLTQQCVYKRIVTFSTKTAEHVIENQEEQKKEAPPTTPTSPV--NRKTIIPANYR 63
            |.||.|.:  ||.|.       .|.......::.:.|..|.:.||    .||  ::.....:..|
 Frog    32 MALSVRSL--RLIQH-------RFGFSPPVRLLTDGEPTKFQPPP----KPVIIDKTKSKESERR 83

  Fly    64 FVYPEFLPDPKVEWRNLVREKLERLDMLDRRKQIDLPEFYVGSVLAVTSSDPHAAGKTSRFVGIC 128
            |:.|||:| |:.. ::.::..|||.||::|||.:|:|||||||:||||.:|.:::||.:||||||
 Frog    84 FLSPEFIP-PRCR-KDPLKFYLERKDMIERRKVLDVPEFYVGSILAVTMADAYSSGKRNRFVGIC 146

  Fly   129 INRDRCGLRARFILRNVIDHQGMEVVYELYDPTILKIEVLRLEKRLDDSLFYLRDALPEYSTFDE 193
            |.|...||.|.|:|||||:.||:|:.|:||.|.|.:|:||:||||||.:|.|||||||||||||.
 Frog   147 IQRSGNGLGATFVLRNVIEGQGVEMRYDLYSPRIQEIQVLKLEKRLDGNLMYLRDALPEYSTFDF 211

  Fly   194 NME-AEPLEEGAPVPVNDIKVVLRPRPWLERWER--QNLRGVANIDEYLKDKHRLSAAKVQKPWE 255
            ||: |..:.|| .||||.:||.::||||.:||||  .|::|: ..:.||.::|..:|.|:.:|||
 Frog   212 NMKPALSVSEG-EVPVNQLKVKMKPRPWSKRWERPKHNIQGI-RFELYLTERHIEAARKLARPWE 274

  Fly   256 KYDMMKDYRSSIPEEEQTEIFAEVHTELH 284
            ::||:|:|.::..|:   :::.||:.|::
 Frog   275 EFDMLKEYDTTKIEQ---KVWEEVNKEIN 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL19NP_524284.1 Ribosomal_L19 94..183 CDD:294284 54/88 (61%)
mrpl19XP_002936026.4 Ribosomal_L19 116..201 CDD:412361 52/84 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 116 1.000 Domainoid score I5940
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H8851
Inparanoid 1 1.050 222 1.000 Inparanoid score I3450
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1387536at2759
OrthoFinder 1 1.000 - - FOG0004273
OrthoInspector 1 1.000 - - oto104288
Panther 1 1.100 - - LDO PTHR15680
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2755
SonicParanoid 1 1.000 - - X5327
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1212.100

Return to query results.
Submit another query.