DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8032 and kdm1b

DIOPT Version :9

Sequence 1:NP_001262380.1 Gene:CG8032 / 41026 FlyBaseID:FBgn0037606 Length:583 Species:Drosophila melanogaster
Sequence 2:XP_002932724.1 Gene:kdm1b / 100489838 XenbaseID:XB-GENE-982183 Length:821 Species:Xenopus tropicalis


Alignment Length:584 Identity:134/584 - (22%)
Similarity:228/584 - (39%) Gaps:158/584 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 TEEGMANIG----SAGAGDQPQTSGNNTNVKIVIIGAGMAGLSAANHLLQNGCDDFLILEARGRV 75
            :.:|:.|.|    |.|....|:...|.:   :::||||.|||:||..|...|. ...::|||.|:
 Frog   356 SRKGLVNTGVLSVSPGQYLLPKEYHNKS---VIVIGAGPAGLAAARQLHNFGI-KVTVVEARDRI 416

  Fly    76 GGRIVSIPLSNNQKIELGANWIHGVLGNPIFELAVQHGLVSVVNVPKPHKVVATTEDGHQVP--- 137
            |||:..........:..||..::|.:.|||..:..|.|    :.:.|..:.....|:|.::.   
 Frog   417 GGRVWDEKSFKGVIVGKGAQIVNGCINNPIAIMCEQIG----IKMRKLREKCDLIEEGGRLTDPA 477

  Fly   138 --------FNILQEIYEAYVCFLRRCDEYFLCQYSPPPDIHSVGEHINYEIEIYL--SGVQ--DP 190
                    ||.:.::...:     |.|:   .|....|    :|:.|....:.:.  ||:|  |.
 Frog   478 IDKRMDFHFNAVLDVVAEW-----RKDK---TQNQDAP----LGDKIQEICKAFTQESGIQFTDV 530

  Fly   191 KEKRLKQSIFNCLLKRETCITGCNNMDEV-----DLLELGSYTELQGGNIVLPTGYSSILRPLGA 250
            :||.|:..:.|.   ...|   .:|:.:|     |..|.  :.:..|.:.:|..|||.:      
 Frog   531 EEKVLQFHLGNL---EYAC---GSNLHKVSARSWDHNEF--FAQFAGDHTMLGAGYSMV------ 581

  Fly   251 QIAKQSILTKCPVKKIHWKRKKTFTGLETVDENSEDEHSDDSERTVTEVPTGEIRGASVESNTS- 314
                                         :|:.:|                    |..:..||. 
 Frog   582 -----------------------------IDKLAE--------------------GLDIRLNTPI 597

  Fly   315 SNCDYPAGNVRIDCEDGRVFHAAHVICTIPLGVLKNTHRTLFDPVLPQYKQESIENLMFGTVDKI 379
            .|.||.:..|||...||:.|.|...:.|:||.:|:. ....|:|:||:.|.::|.:|..|.::||
 Frog   598 RNVDYTSQEVRITAADGQTFTAQKALVTVPLALLQK-GAIQFNPLLPEKKVKAIHSLGAGVIEKI 661

  Fly   380 FLEYERPFLSADISEIMLLWDD---------------DKRDMNSSEEELASEAYLSKNWFKKIYS 429
            .|::...|           ||:               :||.:.....::..|.            
 Frog   662 ALQFPYRF-----------WDNKIQGADFFGHIPPNCNKRGLFGVFYDMDPEG------------ 703

  Fly   430 FAKVTDTLLLGWVSGREAEYMEKLDHEAVAEKCTEILRNFLQDPYVPKPKRCVCTSWKSQDFTGG 494
                ...:|:..::|.....:::|:.:.|.::|..|||...::..||.|.:...|.|....:...
 Frog   704 ----KHAVLMSVITGDAVTSIQELEDKQVVKQCMVILREVFKEQEVPAPIKYFVTHWAKDPWAHM 764

  Fly   495 AYTSIPVGATQEDIENLAQPLYATPQAMKPAIVFAGEHTHSSFYSTVHGAYLSGRTAAQHLLAS 558
            ||:.:..|.:.|..:.||:.:       :..|.||||.|:..|..||.||||||...|..:..|
 Frog   765 AYSFVKTGGSGEAYDILAEDI-------QGKIFFAGEATNRHFPQTVSGAYLSGVREASKITTS 821

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8032NP_001262380.1 NAD_binding_8 44..104 CDD:290186 21/59 (36%)
Amino_oxidase 49..556 CDD:279874 122/542 (23%)
kdm1bXP_002932724.1 zf-CW 138..191 CDD:369393
PLN02328 <301..818 CDD:215187 133/579 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2622
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.