DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p and Saa4

DIOPT Version :9

Sequence 1:NP_001303455.1 Gene:p / 41025 FlyBaseID:FBgn0086679 Length:826 Species:Drosophila melanogaster
Sequence 2:NP_001009478.1 Gene:Saa4 / 365245 RGDID:1307371 Length:130 Species:Rattus norvegicus


Alignment Length:124 Identity:23/124 - (18%)
Similarity:41/124 - (33%) Gaps:49/124 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   627 WEVDDATRDHIAAGFVLLNTSQNAEIVKCEHCSFPLRFDTSCQYHELGAVLLRYFWSRGEQLKCF 691
            |::..|.||::.|      ..||::                           :||::||.    |
  Rat    33 WDLCRAYRDNLRA------NHQNSD---------------------------QYFYARGN----F 60

  Fly   692 DVVQS------VPALLDVLAKFYLAEQNLTKVVAIVLNYGLPELLADVGKQLSVSAWGR 744
            :..|.      ...::....|::....|  :....:.::|| |.|....|   ...|||
  Rat    61 EAQQRGSGGVWAAKIISTGRKYFQGLMN--RYYFGIRDHGL-ESLQSTQK---AEEWGR 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pNP_001303455.1 WD40 <17..>132 CDD:225201
WD40 <21..128 CDD:295369
WD40 repeat 25..63 CDD:293791
WD40 repeat 68..107 CDD:293791
WD40 repeat 116..154 CDD:293791
WD40 repeat 161..196 CDD:293791
WD40 repeat 204..245 CDD:293791
Saa4NP_001009478.1 SAA 23..130 CDD:278695 23/124 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166347808
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.