DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11753 and SYS1

DIOPT Version :9

Sequence 1:NP_649809.1 Gene:CG11753 / 41023 FlyBaseID:FBgn0037603 Length:160 Species:Drosophila melanogaster
Sequence 2:NP_001184058.1 Gene:SYS1 / 90196 HGNCID:16162 Length:156 Species:Homo sapiens


Alignment Length:157 Identity:66/157 - (42%)
Similarity:96/157 - (61%) Gaps:3/157 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 GTFRNTQWDPTLLSSQIVSMQFCVYFTLGLLVFVANKLSGDNYSLDHLFEYHEIHIYDMGGRLVI 68
            |.||:..|||.|:.||||.||...|.:|||.:.:.:.|...:.|||.:|:...:......|||.:
Human     3 GQFRSYVWDPLLILSQIVLMQTVYYGSLGLWLALVDGLVRSSPSLDQMFDAEILGFSTPPGRLSM 67

  Fly    69 CAFVLNAFLASLALWCIVRRAKLCLDFSCTFHVLHLLICWWYNRSFPANASWWLLNVITGTIMCI 133
            .:|:|||...:|.|...:||.|.||||:.|.|..|||.||:|:..||:..:|||:..:...:|.:
Human    68 MSFILNALTCALGLLYFIRRGKQCLDFTVTVHFFHLLGCWFYSSRFPSALTWWLVQAVCIALMAV 132

  Fly   134 GGEFLCLQTEMKEIPVGYAALNQKSDV 160
            .||:||::||:||||:..|   .||:|
Human   133 IGEYLCMRTELKEIPLNSA---PKSNV 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11753NP_649809.1 SYS1 6..149 CDD:370705 60/142 (42%)
SYS1NP_001184058.1 SYS1 5..148 CDD:370705 60/142 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143154
Domainoid 1 1.000 128 1.000 Domainoid score I5325
eggNOG 1 0.900 - - E1_KOG4697
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H43135
Inparanoid 1 1.050 131 1.000 Inparanoid score I4641
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55603
OrthoDB 1 1.010 - - D1583277at2759
OrthoFinder 1 1.000 - - FOG0006601
OrthoInspector 1 1.000 - - oto89099
orthoMCL 1 0.900 - - OOG6_103385
Panther 1 1.100 - - LDO PTHR12952
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2304
SonicParanoid 1 1.000 - - X4838
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.