DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11753 and SYS1

DIOPT Version :9

Sequence 1:NP_649809.1 Gene:CG11753 / 41023 FlyBaseID:FBgn0037603 Length:160 Species:Drosophila melanogaster
Sequence 2:NP_012530.1 Gene:SYS1 / 853453 SGDID:S000003541 Length:203 Species:Saccharomyces cerevisiae


Alignment Length:142 Identity:37/142 - (26%)
Similarity:73/142 - (51%) Gaps:2/142 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FRNTQWDPTLLSSQIVSMQFCVYFTLGLLVFVANKLSGDNYSL-DHLFEYHEIHIYDMGGRLVIC 69
            |:.....|:.:..|||.:|...|.|..:|.:...||:|.:.:: :.||.:..|...:..|..:..
Yeast    20 FKQDSLSPSKIGLQIVLLQIFYYTTAIVLFYCWAKLAGYDLNIKEWLFSWENIDFTNAYGLSISL 84

  Fly    70 AFVLNAFLASLALWCIVRRAKLCLDFSCTFHVLHLLICWWYNRSFPANASWWLLNVITGTIMCIG 134
            .::|::.:....|..||.|:||..||:.|.|.::.::.:.|.|.|| :.||:.|.:::..|:...
Yeast    85 LWLLDSLICVFFLTVIVGRSKLAWDFAITIHAINFIVVFLYTRKFP-SFSWFFLQILSSLILIFL 148

  Fly   135 GEFLCLQTEMKE 146
            |.:.....|:::
Yeast   149 GTWTTRWRELRD 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11753NP_649809.1 SYS1 6..149 CDD:370705 37/142 (26%)
SYS1NP_012530.1 SYS1 20..163 CDD:370705 37/142 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157342000
Domainoid 1 1.000 63 1.000 Domainoid score I2468
eggNOG 1 0.900 - - E1_KOG4697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 63 1.000 Inparanoid score I1749
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55603
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto99254
orthoMCL 1 0.900 - - OOG6_103385
Panther 1 1.100 - - LDO PTHR12952
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2304
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.790

Return to query results.
Submit another query.