DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11753 and Sys1

DIOPT Version :9

Sequence 1:NP_649809.1 Gene:CG11753 / 41023 FlyBaseID:FBgn0037603 Length:160 Species:Drosophila melanogaster
Sequence 2:XP_001062200.2 Gene:Sys1 / 685079 RGDID:1583224 Length:156 Species:Rattus norvegicus


Alignment Length:157 Identity:67/157 - (42%)
Similarity:95/157 - (60%) Gaps:3/157 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 GTFRNTQWDPTLLSSQIVSMQFCVYFTLGLLVFVANKLSGDNYSLDHLFEYHEIHIYDMGGRLVI 68
            |.||:..|||.|:.||||.||...|.:|||.:.:.:.|...:.|||.:|:...:......|||.:
  Rat     3 GQFRSYVWDPLLILSQIVLMQTVYYGSLGLWLALVDALVRSSPSLDQMFDAEILGFSTPPGRLSM 67

  Fly    69 CAFVLNAFLASLALWCIVRRAKLCLDFSCTFHVLHLLICWWYNRSFPANASWWLLNVITGTIMCI 133
            .:|||||...:|.|...:||.|.||||:.|.|..|||.||.|:..||:..:|||:..:...:|.:
  Rat    68 MSFVLNALTCALGLLYFIRRGKQCLDFTVTVHFFHLLGCWLYSSRFPSALTWWLVQAVCIALMAV 132

  Fly   134 GGEFLCLQTEMKEIPVGYAALNQKSDV 160
            .||:||::||:||||:..|   .||:|
  Rat   133 IGEYLCMRTELKEIPLSSA---PKSNV 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11753NP_649809.1 SYS1 6..149 CDD:370705 61/142 (43%)
Sys1XP_001062200.2 SYS1 5..148 CDD:370705 61/142 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166336874
Domainoid 1 1.000 128 1.000 Domainoid score I5195
eggNOG 1 0.900 - - E1_KOG4697
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H43135
Inparanoid 1 1.050 131 1.000 Inparanoid score I4538
OMA 1 1.010 - - QHG55603
OrthoDB 1 1.010 - - D1583277at2759
OrthoFinder 1 1.000 - - FOG0006601
OrthoInspector 1 1.000 - - oto96229
orthoMCL 1 0.900 - - OOG6_103385
Panther 1 1.100 - - LDO PTHR12952
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4838
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.770

Return to query results.
Submit another query.