DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11753 and sys1

DIOPT Version :9

Sequence 1:NP_649809.1 Gene:CG11753 / 41023 FlyBaseID:FBgn0037603 Length:160 Species:Drosophila melanogaster
Sequence 2:NP_001016050.1 Gene:sys1 / 548804 XenbaseID:XB-GENE-5820723 Length:156 Species:Xenopus tropicalis


Alignment Length:157 Identity:64/157 - (40%)
Similarity:95/157 - (60%) Gaps:3/157 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 GTFRNTQWDPTLLSSQIVSMQFCVYFTLGLLVFVANKLSGDNYSLDHLFEYHEIHIYDMGGRLVI 68
            |.||:..|||.|:.|||:.||...|..|||.:.|.:.:...:.|||.:|....:....:.||:.:
 Frog     3 GQFRSYIWDPVLIISQILLMQLIYYSCLGLWIAVLDLVVHYSPSLDQIFNCGILGFSSVPGRVSM 67

  Fly    69 CAFVLNAFLASLALWCIVRRAKLCLDFSCTFHVLHLLICWWYNRSFPANASWWLLNVITGTIMCI 133
            .||:||:...:|.|...:||.|.||||:.|.|:.||..||.|....|::.:||||||:...:|.:
 Frog    68 MAFILNSLTCALGLLYFIRRGKQCLDFTVTVHLFHLFGCWIYTSQLPSSFTWWLLNVVCIALMAV 132

  Fly   134 GGEFLCLQTEMKEIPVGYAALNQKSDV 160
            .||:||::||::|||:..|   .||:|
 Frog   133 IGEYLCMRTELREIPLNSA---PKSNV 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11753NP_649809.1 SYS1 6..149 CDD:370705 58/142 (41%)
sys1NP_001016050.1 SYS1 5..148 CDD:370705 58/142 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 126 1.000 Domainoid score I5383
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H43135
Inparanoid 1 1.050 127 1.000 Inparanoid score I4534
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1583277at2759
OrthoFinder 1 1.000 - - FOG0006601
OrthoInspector 1 1.000 - - oto102954
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2304
SonicParanoid 1 1.000 - - X4838
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
99.090

Return to query results.
Submit another query.